AJ419712

EST Overview
NameAJ419712
Unique NameAJ419712
TypeEST
OrganismPisum sativum (pea)
Sequence length353
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
Pisum sativum unigene v12010-12-27
Homology Analysis: Pisum sativum unigene v1 vs Trembl2010-12-28
Homology Analysis: Pisum sativum unigene v1 vs Swissprot2010-12-28
InterProScan analysis for Pisum sativum unigene v12010-12-29
Libraries
Library NameType
LIBEST_010632 Pisum sativum arbuscular mycorrhizacdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Pisum sativum unigene v1Pisum sativum unigene v1EST
Homology
BLAST of AJ419712 vs. TrEMBL
Match: Q9LEN3_CICAR (Putative uncharacterized protein (Fragment) OS=Cicer arietinum PE=2 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 1.239e-27
Identity = 60/76 (78.95%), Postives = 66/76 (86.84%), Query Frame = 3
Query:    3 NFGIIGGTGLADTLEKVSFKSQLVEGPNGGSIRNVHVDYFTKGDYNLSEEELKASKAKVEGLVKFVDGYLLANPDY 230
            NF IIGGTGLADTLEKVSFKSQL +  NGG+IR VHV+YFTKGDY L+EEELKA K KVEGL+K  +GYLLANPDY
Sbjct:   16 NFSIIGGTGLADTLEKVSFKSQLFDDENGGTIRKVHVEYFTKGDYQLTEEELKAGKDKVEGLIKICEGYLLANPDY 91          
BLAST of AJ419712 vs. TrEMBL
Match: C6T376_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 9.818e-25
Identity = 57/76 (75.00%), Postives = 63/76 (82.89%), Query Frame = 3
Query:    3 NFGIIGGTGLADTLEKVSFKSQLVEGPNGGSIRNVHVDYFTKGDYNLSEEELKASKAKVEGLVKFVDGYLLANPDY 230
            NF I  GT LADTLEKVSF+SQLVE PNGGSIR V V +FTKGD  LSEEEL A+KAK++GLVK V+GYLL NPDY
Sbjct:   82 NFSITEGTALADTLEKVSFESQLVEAPNGGSIRKVSVQFFTKGDATLSEEELTANKAKIQGLVKLVEGYLLVNPDY 157          
BLAST of AJ419712 vs. TrEMBL
Match: Q94IM3_MEDSA (Class 10 PR protein OS=Medicago sativa GN=pr10.2 PE=3 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 2.767e-19
Identity = 46/76 (60.53%), Postives = 58/76 (76.32%), Query Frame = 3
Query:    3 NFGIIGGTGLADTLEKVSFKSQLVEGPNGGSIRNVHVDYFTKGDYNLSEEELKASKAKVEGLVKFVDGYLLANPDY 230
            N+ I+GG  L DT+EK+SF+++L  GPNGGSI  + V YFTKGD   SEEELK+ KAK +GL K ++GY LANPDY
Sbjct:   82 NYSIVGGDSLPDTVEKISFEAKLSAGPNGGSIAKLSVKYFTKGDATPSEEELKSGKAKGDGLFKALEGYCLANPDY 157          
BLAST of AJ419712 vs. TrEMBL
Match: C6T3L5_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 2.767e-19
Identity = 45/76 (59.21%), Postives = 60/76 (78.95%), Query Frame = 3
Query:    3 NFGIIGGTGLADTLEKVSFKSQLVEGPNGGSIRNVHVDYFTKGDYNLSEEELKASKAKVEGLVKFVDGYLLANPDY 230
            N+ ++GG GL DT+EK+SF+++LVEG +GGSI  + V Y TKGD N SEEELK+ KAK + L K ++GY+LANPDY
Sbjct:   82 NYSVVGGVGLPDTVEKISFEAKLVEGASGGSIAKITVKYQTKGDVNPSEEELKSGKAKGDALFKALEGYVLANPDY 157          
BLAST of AJ419712 vs. TrEMBL
Match: C6T206_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 3.614e-19
Identity = 45/76 (59.21%), Postives = 59/76 (77.63%), Query Frame = 3
Query:    3 NFGIIGGTGLADTLEKVSFKSQLVEGPNGGSIRNVHVDYFTKGDYNLSEEELKASKAKVEGLVKFVDGYLLANPDY 230
            N+ ++GG GL DT+EK+SF+++LV  PNGGSI  + V Y TKGD N SEEELK+ KAK + L K ++GY+LANPDY
Sbjct:   82 NYSVVGGVGLPDTVEKISFEAKLVADPNGGSIAKITVKYQTKGDANPSEEELKSGKAKGDALFKALEGYVLANPDY 157          
BLAST of AJ419712 vs. TrEMBL
Match: Q7FNV7_MEDSA (Class 10 PR protein OS=Medicago sativa PE=3 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 8.050e-19
Identity = 45/76 (59.21%), Postives = 59/76 (77.63%), Query Frame = 3
Query:    3 NFGIIGGTGLADTLEKVSFKSQLVEGPNGGSIRNVHVDYFTKGDYNLSEEELKASKAKVEGLVKFVDGYLLANPDY 230
            N+ I+GG GL DT+EK+SF+S+L  GP+GGSI  + V YFTKGD   SEEE+K  KA+ +GL K ++GY+LANPDY
Sbjct:   82 NYSIVGGGGLPDTVEKISFESKLSAGPDGGSIAKLTVKYFTKGDAAPSEEEIKGGKARGDGLFKALEGYVLANPDY 157          
BLAST of AJ419712 vs. TrEMBL
Match: P93333_MEDTR (PR10-1 protein OS=Medicago truncatula GN=PR10-1 PE=2 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 8.050e-19
Identity = 45/76 (59.21%), Postives = 59/76 (77.63%), Query Frame = 3
Query:    3 NFGIIGGTGLADTLEKVSFKSQLVEGPNGGSIRNVHVDYFTKGDYNLSEEELKASKAKVEGLVKFVDGYLLANPDY 230
            N+ I+GG GL DT+EK+SF+S+L  GP+GGSI  + V YFTKGD   SEEE+K  KA+ +GL K ++GY+LANPDY
Sbjct:   82 NYSIVGGGGLPDTVEKISFESKLSAGPDGGSIAKLTVKYFTKGDAAPSEEEIKGGKARGDGLFKALEGYVLANPDY 157          
BLAST of AJ419712 vs. TrEMBL
Match: Q9SAT3_PEA (Root hair protein RH2 (Fragment) OS=Pisum sativum GN=rh2 PE=2 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 1.373e-18
Identity = 44/76 (57.89%), Postives = 58/76 (76.32%), Query Frame = 3
Query:    3 NFGIIGGTGLADTLEKVSFKSQLVEGPNGGSIRNVHVDYFTKGDYNLSEEELKASKAKVEGLVKFVDGYLLANPDY 230
            N+ I+GG GL DT+EK+SF+++L  GPNGGSI  + V Y+TKGD   SEEE+K  KAK EG+ K ++GY +ANPDY
Sbjct:   79 NYSIVGGVGLPDTVEKISFEAKLSAGPNGGSIAKLSVKYYTKGDAIPSEEEIKNGKAKGEGIFKALEGYCVANPDY 154          
BLAST of AJ419712 vs. TrEMBL
Match: O24253_PEA (Pathogenesis-related protein PR10 (Fragment) OS=Pisum sativum subsp. elatius GN=Ypr10.Pi.ela.3 PE=3 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 1.373e-18
Identity = 44/76 (57.89%), Postives = 58/76 (76.32%), Query Frame = 3
Query:    3 NFGIIGGTGLADTLEKVSFKSQLVEGPNGGSIRNVHVDYFTKGDYNLSEEELKASKAKVEGLVKFVDGYLLANPDY 230
            N+ I+GG GL DT+EK+SF+++L  GPNGGSI  + V Y+TKGD   SEEE+K  KAK EG+ K ++GY +ANPDY
Sbjct:   35 NYSIVGGVGLPDTVEKISFEAKLSAGPNGGSIAKLSVKYYTKGDAIPSEEEIKNGKAKGEGIFKALEGYCVANPDY 110          
BLAST of AJ419712 vs. TrEMBL
Match: Q40320_MEDSA (Srg1 OS=Medicago sativa GN=SRG1 PE=2 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 3.059e-18
Identity = 44/76 (57.89%), Postives = 58/76 (76.32%), Query Frame = 3
Query:    3 NFGIIGGTGLADTLEKVSFKSQLVEGPNGGSIRNVHVDYFTKGDYNLSEEELKASKAKVEGLVKFVDGYLLANPDY 230
            N+ I+GG GL DT+EK+SF+S+L  GP+GGS   + V YFTKGD   SEEE+K  KA+ +GL K ++GY+LANPDY
Sbjct:   82 NYSIVGGGGLPDTVEKISFESKLSAGPDGGSTAKLTVKYFTKGDAAPSEEEIKGGKARGDGLFKALEGYVLANPDY 157          
BLAST of AJ419712 vs. SwissProt
Match: DRR4_PEA (Disease resistance response protein DRRG49-C OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 6.924e-20
Identity = 44/76 (57.89%), Postives = 58/76 (76.32%), Query Frame = 3
Query:    3 NFGIIGGTGLADTLEKVSFKSQLVEGPNGGSIRNVHVDYFTKGDYNLSEEELKASKAKVEGLVKFVDGYLLANPDY 230
            N+ I+GG GL DT+EK+SF+++L  GPNGGSI  + V Y+TKGD   SEEE+K  KAK EG+ K ++GY +ANPDY
Sbjct:   82 NYSIVGGVGLPDTVEKISFEAKLSAGPNGGSIAKLSVKYYTKGDAIPSEEEIKNGKAKGEGIFKALEGYCVANPDY 157          
BLAST of AJ419712 vs. SwissProt
Match: DRR3_PEA (Disease resistance response protein Pi49 OS=Pisum sativum GN=DRR49A PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 1.181e-19
Identity = 44/76 (57.89%), Postives = 57/76 (75.00%), Query Frame = 3
Query:    3 NFGIIGGTGLADTLEKVSFKSQLVEGPNGGSIRNVHVDYFTKGDYNLSEEELKASKAKVEGLVKFVDGYLLANPDY 230
            N+ I+GG G  DT+EK+SF+++L  GPNGGSI  + V YFTKGD   SEE+LK  KAK +GL K ++GY LA+PDY
Sbjct:   82 NYSIVGGVGFPDTVEKISFEAKLSAGPNGGSIAKLSVKYFTKGDAAPSEEQLKTDKAKGDGLFKALEGYCLAHPDY 157          
BLAST of AJ419712 vs. SwissProt
Match: PR1_MEDSA (Class-10 pathogenesis-related protein 1 OS=Medicago sativa GN=MSPR10-1 PE=2 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 1.543e-19
Identity = 44/76 (57.89%), Postives = 58/76 (76.32%), Query Frame = 3
Query:    3 NFGIIGGTGLADTLEKVSFKSQLVEGPNGGSIRNVHVDYFTKGDYNLSEEELKASKAKVEGLVKFVDGYLLANPDY 230
            N+ I+GG GL DT+EK+SF+S+L  GP+GGS   + V YFTKGD   SEEE+K  KA+ +GL K ++GY+LANPDY
Sbjct:   82 NYSIVGGGGLPDTVEKISFESKLSAGPDGGSTAKLTVKYFTKGDAAPSEEEIKGGKARGDGLFKALEGYVLANPDY 157          
BLAST of AJ419712 vs. SwissProt
Match: DRR1_PEA (Disease resistance response protein Pi176 OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 5.486e-17
Identity = 41/77 (53.25%), Postives = 57/77 (74.03%), Query Frame = 3
Query:    3 NFGIIGGTGLADTLEKVSFKSQLVEGPNGGSIRNVHVDYFTKGDYNL-SEEELKASKAKVEGLVKFVDGYLLANPDY 230
            N+ I+GG G  DT+EK+SF+++L  GPNGGSI  + V Y+TKGD    +EE+LK+ KAK +GL K ++ Y LA+PDY
Sbjct:   82 NYSIVGGVGFPDTVEKISFEAKLSAGPNGGSIAKLSVKYYTKGDAAAPTEEQLKSDKAKGDGLFKALERYCLAHPDY 158          
BLAST of AJ419712 vs. SwissProt
Match: ABR18_PEA (ABA-responsive protein ABR18 OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 1.596e-16
Identity = 37/76 (48.68%), Postives = 56/76 (73.68%), Query Frame = 3
Query:    3 NFGIIGGTGLADTLEKVSFKSQLVEGPNGGSIRNVHVDYFTKGDYNLSEEELKASKAKVEGLVKFVDGYLLANPDY 230
            N+ I+GG G++D +EK+SF+++L EGPNGGS+  + V Y TKGD    E+E++  KAK + L K ++ Y+LANP+Y
Sbjct:   82 NYSIVGGVGISDIVEKISFEAKLFEGPNGGSVGKMIVKYHTKGDAKPIEKEVEEGKAKGDALFKAIEAYVLANPNY 157          
BLAST of AJ419712 vs. SwissProt
Match: SAM22_SOYBN (Stress-induced protein SAM22 OS=Glycine max PE=1 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 2.085e-16
Identity = 38/76 (50.00%), Postives = 53/76 (69.74%), Query Frame = 3
Query:    3 NFGIIGGTGLADTLEKVSFKSQLVEGPNGGSIRNVHVDYFTKGDYNLSEEELKASKAKVEGLVKFVDGYLLANPDY 230
            ++ ++GG  L DT EK++F S+LV GPNGGS   + V Y TKGD   +++ELK  KAK + L K ++ YLLA+PDY
Sbjct:   82 SYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVKYETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHPDY 157          
BLAST of AJ419712 vs. SwissProt
Match: L18B_LUPLU (Protein LlR18B OS=Lupinus luteus GN=LLR18B PE=1 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 1.035e-15
Identity = 39/76 (51.32%), Postives = 58/76 (76.32%), Query Frame = 3
Query:    3 NFGIIGGTGLADTLEKVSFKSQLVEGPNGGSIRNVHVDYFTKGDYNLSEEELKASKAKVEGLVKFVDGYLLANPDY 230
            N+ I+GGTGL ++LEK++F+S+L+ GP+GGSI  + V + TKGD  LS+   + +KA+  GL K V+GY+LANP+Y
Sbjct:   82 NYSIVGGTGLDESLEKITFESKLLSGPDGGSIGKIKVKFHTKGDV-LSDAVREEAKARGTGLFKAVEGYVLANPNY 156          
BLAST of AJ419712 vs. SwissProt
Match: PR2_PHAVU (Pathogenesis-related protein 2 OS=Phaseolus vulgaris PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 1.765e-15
Identity = 37/74 (50.00%), Postives = 52/74 (70.27%), Query Frame = 3
Query:    3 NFGIIGGTGLADTLEKVSFKSQLVEGPNGGSIRNVHVDYFTKGDYNLSEEELKASKAKVEGLVKFVDGYLLANP 224
            ++ I+GG  L DT EK+S  S+L +GPNGGS+  + + Y +KGD   +E+ELKA KAK + L K ++ YLLANP
Sbjct:   82 SYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIKYHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155          
BLAST of AJ419712 vs. SwissProt
Match: PR1_PHAVU (Pathogenesis-related protein 1 OS=Phaseolus vulgaris PE=1 SV=2)

HSP 1 Score: 80.4925 bits (197), Expect = 3.010e-15
Identity = 37/74 (50.00%), Postives = 53/74 (71.62%), Query Frame = 3
Query:    3 NFGIIGGTGLADTLEKVSFKSQLVEGPNGGSIRNVHVDYFTKGDYNLSEEELKASKAKVEGLVKFVDGYLLANP 224
            ++ I+GG  L +T EK++F S+L +GPNGGS+  + + Y +KGD   +E+ELKA KAK + L K V+ YLLANP
Sbjct:   83 SYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITYHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156          
BLAST of AJ419712 vs. SwissProt
Match: L18A_LUPLU (Protein LlR18A OS=Lupinus luteus GN=LLR18A PE=1 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.951e-14
Identity = 38/76 (50.00%), Postives = 56/76 (73.68%), Query Frame = 3
Query:    3 NFGIIGGTGLADTLEKVSFKSQLVEGPNGGSIRNVHVDYFTKGDYNLSEEELKASKAKVEGLVKFVDGYLLANPDY 230
            N+ IIGG GL ++LEK+S++S+++ GP+GGSI  ++V + TKGD  LSE     +K K  GL K ++GY+LA+PDY
Sbjct:   82 NYSIIGGEGLDESLEKISYESKILPGPDGGSIGKINVKFHTKGDV-LSETVRDQAKFKGLGLFKAIEGYVLAHPDY 156          
The following BLAST results are available for this feature:
BLAST of AJ419712 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
Q9LEN3_CICAR1.239e-2778.95Putative uncharacterized protein (Fragment) OS=Cic... [more]
C6T376_SOYBN9.818e-2575.00Putative uncharacterized protein OS=Glycine max PE... [more]
Q94IM3_MEDSA2.767e-1960.53Class 10 PR protein OS=Medicago sativa GN=pr10.2 P... [more]
C6T3L5_SOYBN2.767e-1959.21Putative uncharacterized protein OS=Glycine max PE... [more]
C6T206_SOYBN3.614e-1959.21Putative uncharacterized protein OS=Glycine max PE... [more]
Q7FNV7_MEDSA8.050e-1959.21Class 10 PR protein OS=Medicago sativa PE=3 SV=1[more]
P93333_MEDTR8.050e-1959.21PR10-1 protein OS=Medicago truncatula GN=PR10-1 PE... [more]
Q9SAT3_PEA1.373e-1857.89Root hair protein RH2 (Fragment) OS=Pisum sativum ... [more]
O24253_PEA1.373e-1857.89Pathogenesis-related protein PR10 (Fragment) OS=Pi... [more]
Q40320_MEDSA3.059e-1857.89Srg1 OS=Medicago sativa GN=SRG1 PE=2 SV=1[more]
back to top
BLAST of AJ419712 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Swissprot)
Total hits: 10
Match NameE-valueIdentityDescription
DRR4_PEA6.924e-2057.89Disease resistance response protein DRRG49-C OS=Pi... [more]
DRR3_PEA1.181e-1957.89Disease resistance response protein Pi49 OS=Pisum ... [more]
PR1_MEDSA1.543e-1957.89Class-10 pathogenesis-related protein 1 OS=Medicag... [more]
DRR1_PEA5.486e-1753.25Disease resistance response protein Pi176 OS=Pisum... [more]
ABR18_PEA1.596e-1648.68ABA-responsive protein ABR18 OS=Pisum sativum PE=2... [more]
SAM22_SOYBN2.085e-1650.00Stress-induced protein SAM22 OS=Glycine max PE=1 S... [more]
L18B_LUPLU1.035e-1551.32Protein LlR18B OS=Lupinus luteus GN=LLR18B PE=1 SV... [more]
PR2_PHAVU1.765e-1550.00Pathogenesis-related protein 2 OS=Phaseolus vulgar... [more]
PR1_PHAVU3.010e-1550.00Pathogenesis-related protein 1 OS=Phaseolus vulgar... [more]
L18A_LUPLU1.951e-1450.00Protein LlR18A OS=Lupinus luteus GN=LLR18A PE=1 SV... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000916Bet v I allergenPRINTSPR00634BETALLERGENcoord: 3..16
score: 2.5e-11coord: 28..44
score: 2.5e-11coord: 62..72
score: 2.5
IPR000916Bet v I allergenPFAMPF00407Bet_v_1coord: 2..73
score: 3.2
NoneNo IPR availableGENE3D3.30.530.20no descriptioncoord: 2..76
score: 1.4
NoneNo IPR availableSUPERFAMILY55961Bet v1-likecoord: 4..76
score: 6.8

Properties
Property NameValue
Singlet in analysisPisum sativum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>AJ419712 ID=AJ419712|Name=AJ419712|organism=Pisum sativum|type=EST|length=353bp
ACAACTTTGGCATTATTGGTGGCACTGGCTTAGCTGACACATTGGAGAAA
GTCTCATTCAAGAGCCAATTGGTGGAAGGTCCAAATGGAGGATCCATTAG
GAATGTGCATGTTGATTATTTTACCAAAGGTGATTACAATCTTAGTGAGG
AGGAGCTGAAAGCTAGTAAAGCTAAGGTTGAAGGACTTGTTAAGTTTGTT
GATGGTTACCTTTTGGCAAATCCTGATTATTGAATGTCTTTWATTAGGGT
TAATAAAAWCTTAGCTATGGTGAAAGTTAATAATAGCCTAAGTTGAAGAT
TTGGTCGTAAGATGAWGCATAAGTTTGAGTGATGAGATTGTTTTTGTATT
TGC
back to top
Annotated Terms
The following terms have been associated with this EST:
Vocabulary: Biological Process
TermDefinition
GO:0006952defense response
GO:0009607response to biotic stimulus
Vocabulary: INTERPRO
TermDefinition
IPR000916Bet_v_I/MLP