CD858795

EST Overview
NameCD858795
Unique NameCD858795
TypeEST
OrganismPisum sativum (pea)
Sequence length685
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
Pisum sativum unigene v12010-12-27
Homology Analysis: Pisum sativum unigene v1 vs Trembl2010-12-28
Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide2011-02-03
InterProScan analysis for Pisum sativum unigene v12010-12-29
Libraries
Library NameType
LIBEST_013997 CIcdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Pisum sativum unigene v1Pisum sativum unigene v1EST
Homology
BLAST of CD858795 vs. TrEMBL
Match: B9T3V5_RICCO (Transferase, transferring glycosyl groups, putative OS=Ricinus communis GN=RCOM_0115300 PE=4 SV=1)

HSP 1 Score: 294.278 bits (752), Expect = 6.109e-78
Identity = 143/223 (64.13%), Postives = 167/223 (74.89%), Query Frame = -1
Query:    2 EVPLGFVESNQSQNAGNGARYHQLDAQRLPSGGWIGVMDGDRVPSGDSLRRLMVGCASXXXXXXXXXXXXXXXXXVNCIVPLHLFIHNSGKRSPTSLSWERPNAFSSKVRRFCSRVNRAPTVLRGKIKQNACARRVILTIIFVVGAGLMCIAFKNIYGGNGSEEPYPLKGQYSQFTLLTMTYDARLWNLKMYVKHYSRCSSVSEIVVVWNQGIPPELSDLDSA 670
            EV LGF E ++ +N  NGARYH LD Q+L +G WIG+MDGDRVPSGDS+RR ++GCAS                 V CIVPL+   + SGKRS T L WERPN FSSKVRRFC R+NRA + LR KI+ N  A ++ L +IF+ G  LMC + KN+YGGNG+EEPYPL G +SQFTLLTMTYDARLWNLKMYVKHYS CSSV EIVVVWN+GIPP+LSDLDSA
Sbjct:  284 EVSLGFEEPSKGRNDWNGARYHHLDVQQLSTGEWIGIMDGDRVPSGDSVRRFILGCASLAAVIAIIMVLGVLLGAVKCIVPLNWCAYYSGKRSDTLLVWERPNVFSSKVRRFCGRLNRAASSLRAKIRPNTWAGKLALAVIFLAGVALMCTSVKNVYGGNGAEEPYPLNGYHSQFTLLTMTYDARLWNLKMYVKHYSSCSSVKEIVVVWNKGIPPKLSDLDSA 506          
BLAST of CD858795 vs. TrEMBL
Match: D7UBS5_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_74.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00034672001 PE=4 SV=1)

HSP 1 Score: 288.115 bits (736), Expect = 4.378e-76
Identity = 143/223 (64.13%), Postives = 164/223 (73.54%), Query Frame = -1
Query:    2 EVPLGFVESNQSQNAGNGARYHQLDAQRLPSGGWIGVMDGDRVPSGDSLRRLMVGCASXXXXXXXXXXXXXXXXXVNCIVPLHLFIHNSGKRSPTSLSWERPNAFSSKVRRFCSRVNRAPTVLRGKIKQNACARRVILTIIFVVGAGLMCIAFKNIYGGNGSEEPYPLKGQYSQFTLLTMTYDARLWNLKMYVKHYSRCSSVSEIVVVWNQGIPPELSDLDSA 670
            EV LG  ESN+ +NA NGARYH LD Q+L  G WIGVMDGDRVPSGD   R ++GCAS                 V CI+PL+   HNSGKRS   L+WER N  SSK+R+ CSR+NRAP  LRG IK N+   R++++ IF VGA L+CIA K IYGGNG+EE YPLKG YSQFTLLTMTY+ARLWNLKMYVKHYSRCSSV EIVVVWN+G PPE S+LDSA
Sbjct:  336 EVSLGIDESNKGRNAWNGARYHHLDVQQLSYGKWIGVMDGDRVPSGDPAHRFILGCASVVVVVAVVILLGSLVGAVKCIIPLNWCPHNSGKRSDVFLTWERSNLMSSKLRQLCSRLNRAPLFLRGMIKPNSIIGRLVISFIFAVGAVLVCIAVKYIYGGNGAEEAYPLKGHYSQFTLLTMTYEARLWNLKMYVKHYSRCSSVEEIVVVWNKGAPPEPSELDSA 558          
BLAST of CD858795 vs. TrEMBL
Match: B9HUX5_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_822613 PE=4 SV=1)

HSP 1 Score: 281.567 bits (719), Expect = 4.098e-74
Identity = 140/222 (63.06%), Postives = 158/222 (71.17%), Query Frame = -1
Query:    5 EVPLGFVESNQSQNAGNGARYHQLDAQRLPSGGWIGVMDGDRVPSGDSLRRLMVGCASXXXXXXXXXXXXXXXXXVNCIVPLHLFIHNSGKRSPTSLSWERPNAFSSKVRRFCSRVNRAPTVLRGKIKQNACARRVILTIIFVVGAGLMCIAFKNIYGGNGSEEPYPLKGQYSQFTLLTMTYDARLWNLKMYVKHYSRCSSVSEIVVVWNQGIPPELSDLDS 670
            EVPLGF ESN+  NA NGARYH LD Q+L SG WI VMDGDRVPSGD + R ++G AS                 V CI+PL+   H SGKR+   L  ER N FSSKVRRFCSR+NR P  +RGKIK N  A +++L +IF VG  LMC   K  YGGNG+EE YPL G YSQFTLLTMTYDARLWNLKMYV+HYSRCSSV EI+VVWN+GIPP  SDLDS
Sbjct:  427 EVPLGFEESNKGPNAWNGARYHHLDVQQLSSGKWIAVMDGDRVPSGDPVHRFILGSASFAAVTVVVVVLGVLLGAVKCIIPLNWCAHFSGKRNNALLGRERLNLFSSKVRRFCSRLNRVPLSVRGKIKPNTWAGKLVLAVIFAVGIALMCAGVKYFYGGNGAEEAYPLNGSYSQFTLLTMTYDARLWNLKMYVRHYSRCSSVKEIIVVWNKGIPPRSSDLDS 648          
BLAST of CD858795 vs. TrEMBL
Match: D7LXJ6_ARALY (Glycosyltransferase family protein 47 OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_908336 PE=4 SV=1)

HSP 1 Score: 217.624 bits (553), Expect = 7.267e-55
Identity = 113/224 (50.45%), Postives = 145/224 (64.73%), Query Frame = -1
Query:    2 EVPLGFVESNQSQNAGNGARYHQLDAQRLPSGGWIGVMDGDRVPSGDSLRRLMVGCASXXXXXXXXXXXXXXXXXVNCIVPLHLFI-HNSGKRSPTSLSWERPNAFSSKVRRFCSRVNRAPTVLRGKIKQNACARRVILTIIFVVGAGLMCIAFKNIYGGNGSEEPYPLKGQYSQFTLLTMTYDARLWNLKMYVKHYSRCSSVSEIVVVWNQGIPPELSDLDSA 670
            EVP  F  S++ +N+ NG R H  D ++L SG +IG++DGDRV SGD   R+++G AS                 VNCIVP    + + +GKR+   L+ E    FS K+RR  SR+NR P  LRG +K N+   +  L +I +VG  L C+  + IYGG+G+ EPYP KG  SQFTL TMTYDARLWNLKMYVK YSRC SV EIVV+WN+G PPEL++LDSA
Sbjct:  343 EVPFSFEASHKGKNSWNGVRQHHFDVKQLSSGEFIGLLDGDRVTSGDLFHRVILGYASLAAAISVVILLGFLLGVVNCIVPSTWCMNYYAGKRTDALLNLETAGLFSEKLRRIGSRLNRVPPFLRGFVKPNSSMGKFTLGVIVLVGLLLTCVGVRYIYGGSGTVEPYPFKGHLSQFTLATMTYDARLWNLKMYVKRYSRCPSVKEIVVIWNKGPPPELTELDSA 566          
BLAST of CD858795 vs. TrEMBL
Match: Q9LZ75_ARATH (Putative uncharacterized protein T32M21_100 OS=Arabidopsis thaliana GN=T32M21_100 PE=4 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 8.035e-54
Identity = 111/224 (49.55%), Postives = 143/224 (63.84%), Query Frame = -1
Query:    2 EVPLGFVESNQSQNAGNGARYHQLDAQRLPSGGWIGVMDGDRVPSGDSLRRLMVGCASXXXXXXXXXXXXXXXXXVNCIVPLHLFI-HNSGKRSPTSLSWERPNAFSSKVRRFCSRVNRAPTVLRGKIKQNACARRVILTIIFVVGAGLMCIAFKNIYGGNGSEEPYPLKGQYSQFTLLTMTYDARLWNLKMYVKHYSRCSSVSEIVVVWNQGIPPELSDLDSA 670
            EVP     S + +N+ NG R H  D ++L SG +IG++DGDRV SGD   R+++G AS                 VNCIVP    + + +GKR+   L+ E    FS K+RR  SR+NR P  LRG +K N+   +  L +I ++G  L C+  + IYGG+G+ EPYP KG  SQFTL TMTYDARLWNLKMYVK YSRC SV EIVV+WN+G PP+LS+LDSA
Sbjct:  342 EVPFSLEASRKGKNSWNGVRQHHFDVKQLSSGEFIGLVDGDRVTSGDLFHRVILGYASLAAAISVVILLGFLLGVVNCIVPSTWCMNYYAGKRTDALLNLETAGLFSEKLRRIGSRLNRVPPFLRGFVKPNSSMGKFTLGVIVILGLLLTCVGVRYIYGGSGAVEPYPFKGHLSQFTLATMTYDARLWNLKMYVKRYSRCPSVKEIVVIWNKGPPPDLSELDSA 565          
BLAST of CD858795 vs. TrEMBL
Match: Q84WB7_ARATH (Putative uncharacterized protein At5g04500 OS=Arabidopsis thaliana GN=At5g04500 PE=2 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 8.035e-54
Identity = 111/224 (49.55%), Postives = 143/224 (63.84%), Query Frame = -1
Query:    2 EVPLGFVESNQSQNAGNGARYHQLDAQRLPSGGWIGVMDGDRVPSGDSLRRLMVGCASXXXXXXXXXXXXXXXXXVNCIVPLHLFI-HNSGKRSPTSLSWERPNAFSSKVRRFCSRVNRAPTVLRGKIKQNACARRVILTIIFVVGAGLMCIAFKNIYGGNGSEEPYPLKGQYSQFTLLTMTYDARLWNLKMYVKHYSRCSSVSEIVVVWNQGIPPELSDLDSA 670
            EVP     S + +N+ NG R H  D ++L SG +IG++DGDRV SGD   R+++G AS                 VNCIVP    + + +GKR+   L+ E    FS K+RR  SR+NR P  LRG +K N+   +  L +I ++G  L C+  + IYGG+G+ EPYP KG  SQFTL TMTYDARLWNLKMYVK YSRC SV EIVV+WN+G PP+LS+LDSA
Sbjct:  343 EVPFSLEASRKGKNSWNGVRQHHFDVKQLSSGEFIGLVDGDRVTSGDLFHRVILGYASLAAAISVVILLGFLLGVVNCIVPSTWCMNYYAGKRTDALLNLETAGLFSEKLRRIGSRLNRVPPFLRGFVKPNSSMGKFTLGVIVILGLLLTCVGVRYIYGGSGAVEPYPFKGHLSQFTLATMTYDARLWNLKMYVKRYSRCPSVKEIVVIWNKGPPPDLSELDSA 566          
BLAST of CD858795 vs. TrEMBL
Match: A9STI2_PHYPA (Predicted protein OS=Physcomitrella patens subsp. patens GN=PHYPADRAFT_135187 PE=4 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 7.039e-50
Identity = 103/225 (45.78%), Postives = 136/225 (60.44%), Query Frame = -1
Query:    2 EVPLGFVESNQSQNAGNGARYHQLDAQRLPSGGWIGVMDGDRVPSGDSLRRLMVGCASXXXXXXXXXXXXXXXXXVNC-IVPLHLFIHNSGKRSPTSLSWERPNAFSSKVRRFCSRVNRAPTVLRGKIKQNACARRVILTIIFVVGAGLMCIAFKNIYGGNGSEEPYPLKGQYSQFTLLTMTYDARLWNLKMYVKHYSRCSSVSEIVVVWNQGIPPELS-DLDSA 670
            EVPL   ES + +NA NG RYH L+  +LPSG WI V DGDRVPSGD   +L +G  +                   C + PL + +  S K + T L W      S ++ R  SR+NR  + LR  +  N+C R     + FV+    +C+   + +GGNG++EP+P+ GQYSQFT++ MTYDARLWNL+MYVKHYSRC+SV EIVVVWN+G PP  + D DSA
Sbjct:  319 EVPLNLEESKKGRNAWNGMRYHHLNPHQLPSGEWIAVGDGDRVPSGDLEMQLALGVGALLIVVLLSITVGVVSGYGRCWLPPLSITLPGSKKPTETLLPWVMRPQLSGRLYRSVSRLNRVGSTLRKSLPANSCFRCSFGVLCFVISVCAICVVVSSFFGGNGAQEPHPVNGQYSQFTMVAMTYDARLWNLQMYVKHYSRCTSVREIVVVWNKGTPPNPALDFDSA 543          
BLAST of CD858795 vs. TrEMBL
Match: Q9AUK5_ORYSA (Putative exostoses OS=Oryza sativa GN=OSJNBb0072E24.4 PE=4 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 2.675e-49
Identity = 104/223 (46.64%), Postives = 139/223 (62.33%), Query Frame = -1
Query:    5 EVPLGFVESNQSQNAGNGARYHQLDAQRLPSGG-WIGVMDGDRVPSGDSLRRLMVGCASXXXXXXXXXXXXXXXXXVNCIVPLHLFIHNSGKRSPTSLSWERPNAFSSKVRRFCSRVNRAPTVLRGKIKQNACARRVILTIIFVVGAGLMCIAFKNIYGGNGSEEPYPLKGQYSQFTLLTMTYDARLWNLKMYVKHYSRCSSVSEIVVVWNQGIPPELSDLDS 670
            EVP    +  + +NA NGAR H LD Q+LPSG  WIGVMDGDRVPSGDS+ RL +G                    +NC +PL   + ++ KRS    + E+      K+    S +N+  +++ G+I    C  RV + ++ ++   L C+    IYGGNG+EEPYP+KG+YSQFTLLTMTYDARLWNLKM+V+HYS C+SV +IVVVWN+G PP   +L S
Sbjct:  322 EVPFVINKQLKGRNAWNGARSHHLDVQQLPSGKPWIGVMDGDRVPSGDSVHRLTIGYMIYGVVLILVLVTGGLIGTINCSLPLRWSLPHTEKRSGL-FNVEQRFFLYHKLSSLISNLNKLGSLICGRINYRTCKGRVYVVVVMLILVVLTCVGTHYIYGGNGAEEPYPIKGKYSQFTLLTMTYDARLWNLKMFVEHYSNCASVRDIVVVWNKGQPPAQGELKS 543          
BLAST of CD858795 vs. TrEMBL
Match: Q10F19_ORYSJ (Expressed protein OS=Oryza sativa subsp. japonica GN=LOC_Os03g48010 PE=4 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 2.675e-49
Identity = 104/223 (46.64%), Postives = 139/223 (62.33%), Query Frame = -1
Query:    5 EVPLGFVESNQSQNAGNGARYHQLDAQRLPSGG-WIGVMDGDRVPSGDSLRRLMVGCASXXXXXXXXXXXXXXXXXVNCIVPLHLFIHNSGKRSPTSLSWERPNAFSSKVRRFCSRVNRAPTVLRGKIKQNACARRVILTIIFVVGAGLMCIAFKNIYGGNGSEEPYPLKGQYSQFTLLTMTYDARLWNLKMYVKHYSRCSSVSEIVVVWNQGIPPELSDLDS 670
            EVP    +  + +NA NGAR H LD Q+LPSG  WIGVMDGDRVPSGDS+ RL +G                    +NC +PL   + ++ KRS    + E+      K+    S +N+  +++ G+I    C  RV + ++ ++   L C+    IYGGNG+EEPYP+KG+YSQFTLLTMTYDARLWNLKM+V+HYS C+SV +IVVVWN+G PP   +L S
Sbjct:  322 EVPFVINKQLKGRNAWNGARSHHLDVQQLPSGKPWIGVMDGDRVPSGDSVHRLTIGYMIYGVVLILVLVTGGLIGTINCSLPLRWSLPHTEKRSGL-FNVEQRFFLYHKLSSLISNLNKLGSLICGRINYRTCKGRVYVVVVMLILVVLTCVGTHYIYGGNGAEEPYPIKGKYSQFTLLTMTYDARLWNLKMFVEHYSNCASVRDIVVVWNKGQPPAQGELKS 543          
BLAST of CD858795 vs. TrEMBL
Match: Q0DPK4_ORYSJ (Os03g0684500 protein OS=Oryza sativa subsp. japonica GN=Os03g0684500 PE=4 SV=2)

HSP 1 Score: 199.134 bits (505), Expect = 2.675e-49
Identity = 104/223 (46.64%), Postives = 139/223 (62.33%), Query Frame = -1
Query:    5 EVPLGFVESNQSQNAGNGARYHQLDAQRLPSGG-WIGVMDGDRVPSGDSLRRLMVGCASXXXXXXXXXXXXXXXXXVNCIVPLHLFIHNSGKRSPTSLSWERPNAFSSKVRRFCSRVNRAPTVLRGKIKQNACARRVILTIIFVVGAGLMCIAFKNIYGGNGSEEPYPLKGQYSQFTLLTMTYDARLWNLKMYVKHYSRCSSVSEIVVVWNQGIPPELSDLDS 670
            EVP    +  + +NA NGAR H LD Q+LPSG  WIGVMDGDRVPSGDS+ RL +G                    +NC +PL   + ++ KRS    + E+      K+    S +N+  +++ G+I    C  RV + ++ ++   L C+    IYGGNG+EEPYP+KG+YSQFTLLTMTYDARLWNLKM+V+HYS C+SV +IVVVWN+G PP   +L S
Sbjct:  322 EVPFVINKQLKGRNAWNGARSHHLDVQQLPSGKPWIGVMDGDRVPSGDSVHRLTIGYMIYGVVLILVLVTGGLIGTINCSLPLRWSLPHTEKRSGL-FNVEQRFFLYHKLSSLISNLNKLGSLICGRINYRTCKGRVYVVVVMLILVVLTCVGTHYIYGGNGAEEPYPIKGKYSQFTLLTMTYDARLWNLKMFVEHYSNCASVRDIVVVWNKGQPPAQGELKS 543          
BLAST of CD858795 vs. TAIR peptide
Match: AT5G04500.1 (| Symbols: | glycosyltransferase family protein 47 | chr5:1283604-1286155 FORWARD LENGTH=765)

HSP 1 Score: 214.157 bits (544), Expect = 5.480e-56
Identity = 111/224 (49.55%), Postives = 143/224 (63.84%), Query Frame = -1
Query:    2 EVPLGFVESNQSQNAGNGARYHQLDAQRLPSGGWIGVMDGDRVPSGDSLRRLMVGCASXXXXXXXXXXXXXXXXXVNCIVPLHLFI-HNSGKRSPTSLSWERPNAFSSKVRRFCSRVNRAPTVLRGKIKQNACARRVILTIIFVVGAGLMCIAFKNIYGGNGSEEPYPLKGQYSQFTLLTMTYDARLWNLKMYVKHYSRCSSVSEIVVVWNQGIPPELSDLDSA 670
            EVP     S + +N+ NG R H  D ++L SG +IG++DGDRV SGD   R+++G AS                 VNCIVP    + + +GKR+   L+ E    FS K+RR  SR+NR P  LRG +K N+   +  L +I ++G  L C+  + IYGG+G+ EPYP KG  SQFTL TMTYDARLWNLKMYVK YSRC SV EIVV+WN+G PP+LS+LDSA
Sbjct:  343 EVPFSLEASRKGKNSWNGVRQHHFDVKQLSSGEFIGLVDGDRVTSGDLFHRVILGYASLAAAISVVILLGFLLGVVNCIVPSTWCMNYYAGKRTDALLNLETAGLFSEKLRRIGSRLNRVPPFLRGFVKPNSSMGKFTLGVIVILGLLLTCVGVRYIYGGSGAVEPYPFKGHLSQFTLATMTYDARLWNLKMYVKRYSRCPSVKEIVVIWNKGPPPDLSELDSA 566          
The following BLAST results are available for this feature:
Homology Analysis: Pisum sativum unigene v1 vs Trembl
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
B9T3V5_RICCO6.109e-7864.13Transferase, transferring glycosyl groups, putativ... [more]
D7UBS5_VITVI4.378e-7664.13Whole genome shotgun sequence of line PN40024, sca... [more]
B9HUX5_POPTR4.098e-7463.06Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
D7LXJ6_ARALY7.267e-5550.45Glycosyltransferase family protein 47 OS=Arabidops... [more]
Q9LZ75_ARATH8.035e-5449.55Putative uncharacterized protein T32M21_100 OS=Ara... [more]
Q84WB7_ARATH8.035e-5449.55Putative uncharacterized protein At5g04500 OS=Arab... [more]
A9STI2_PHYPA7.039e-5045.78Predicted protein OS=Physcomitrella patens subsp. ... [more]
Q9AUK5_ORYSA2.675e-4946.64Putative exostoses OS=Oryza sativa GN=OSJNBb0072E2... [more]
Q10F19_ORYSJ2.675e-4946.64Expressed protein OS=Oryza sativa subsp. japonica ... [more]
Q0DPK4_ORYSJ2.675e-4946.64Os03g0684500 protein OS=Oryza sativa subsp. japoni... [more]
back to top
Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide)
Total hits: 1
Match NameE-valueIdentityDescription
AT5G04500.15.480e-5649.55| Symbols: | glycosyltransferase family protein 4... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSEGsegsegcoord: 15..28
score
NoneNo IPR availableSEGsegsegcoord: 11..20
score
NoneNo IPR availableGENE3D3.90.550.10no descriptioncoord: 177..222
score: 1.6
NoneNo IPR availablePANTHERPTHR11062EXOSTOSIN (HEPARAN SULFATE GLYCOSYLTRANSFERASE)-RELATEDcoord: 6..228
score: 6.5
NoneNo IPR availablePANTHERPTHR11062:SF2EXOSTOSIN-RELATEDcoord: 6..228
score: 6.5
NoneNo IPR availableSEGsegsegcoord: 64..81
score
IPR015338EXTL2, alpha-1,4-N-acetylhexosaminyltransferasePFAMPF09258Glyco_transf_64coord: 180..221
score: 7.9

Properties
Property NameValue
Singlet in analysisPisum sativum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>CD858795 ID=CD858795|Name=CD858795|organism=Pisum sativum|type=EST|length=685bp
CCGCTGAATCTAGATCACTCAGTTCTGGAGGGATTCCCTGGTTCCACACC
ACAACTATTTCGGACACCGAAGAGCATCTTGAGTAATGTTTCACATACAT
CTTCAGGTTCCAGAGACGAGCATCGTAGGTCATTGTTAATAATGTGAACT
GCGAGTATTGACCTTTCAATGGATATGGTTCTTCTGAACCGTTACCACCA
TAAATGTTTTTGAACGCTATGCACATCAATCCAGCCCCAACTACAAAAAT
TATAGTAAGAATAACCCTCCTGGCACAAGCATTTTGCTTTATCTTACCTC
GGAGAACCGTTGGGGCTCGGTTCACGCGGCTACAGAACCGTCTTACTTTT
GAAGAGAATGCATTTGGCCTTTCCCAAGACAAAGAAGTTGGACTCCTCTT
CCCTGAGTTATGAATGAACAAATGGAGAGGGACAATACAATTCACAAACC
CGAGTAACACACCCAATAGCACAATGAATATAGCAGCGACTACAACAGAA
GCACAACCAACCATGAGCCGTCGGAGTGAATCTCCAGAAGGAACACGGTC
CCCATCCATTACACCAATCCAACCACCAGAGGGAAGACGTTGGGCATCTA
ACTGATGGTATCTAGCACCATTCCCAGCATTTTGACTCTGGTTTGACTCA
ACAAAGCCCAAAGGTACCTCGGCCGCGACCACGCC
back to top
Annotated Terms
The following terms have been associated with this EST:
Vocabulary: Cellular Component
TermDefinition
GO:0031227intrinsic component of endoplasmic reticulum membrane
Vocabulary: INTERPRO
TermDefinition
IPR015338GT64