CD860433

EST Overview
NameCD860433
Unique NameCD860433
TypeEST
OrganismPisum sativum (pea)
Sequence length331
Libraries
Library NameType
LIBEST_014003 TEcdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Pisum sativum unigene v1Pisum sativum unigene v1EST
Homology
BLAST of CD860433 vs. TrEMBL
Match: B7FM23_MEDTR (Putative uncharacterized protein OS=Medicago truncatula PE=2 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 2.927e-40
Identity = 84/99 (84.85%), Postives = 90/99 (90.91%), Query Frame = 2
Query:    2 VNGVPWVVWPLYAEQKMNAVILTEDVKVGLRPIVNENGLVERQEIASVVKCLMEGEEGKKLRYKMKDLKEAAAKTLGENGTSTKIISKLALKWSNGNNI 298
            VNGVP VVWPLYAEQKMNAV+LTEDVKVGLRP V ENGLVER EIASVVKCLMEGEEGKKLRY+MKDLKEAA+KTLGENGTST  IS LALKW+N + +
Sbjct:  383 VNGVPLVVWPLYAEQKMNAVMLTEDVKVGLRPNVGENGLVERLEIASVVKCLMEGEEGKKLRYQMKDLKEAASKTLGENGTSTNHISNLALKWTNKSTV 481          
BLAST of CD860433 vs. TrEMBL
Match: A4F1R9_CLITE (Putative glycosyltransferase OS=Clitoria ternatea GN=CtGT22 PE=2 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 6.748e-37
Identity = 78/100 (78.00%), Postives = 85/100 (85.00%), Query Frame = 2
Query:    2 VNGVPWVVWPLYAEQKMNAVILTEDVKVGLRPIVNENGLVERQEIASVVKCLMEGEEGKKLRYKMKDLKEAAAKTLGENGTSTKIISKLALKWSNGNNIS 301
            VNGVP V WPLYAEQKMNAV+LT DVKV LRP V ENGLVERQEIASVVKCLMEGEEGKKLRY++KDLK+AAAK + ENG ST  IS LALKW+N   +S
Sbjct:  379 VNGVPLVAWPLYAEQKMNAVMLTRDVKVALRPCVGENGLVERQEIASVVKCLMEGEEGKKLRYRIKDLKDAAAKAIAENGPSTHHISHLALKWTNKPTVS 478          
BLAST of CD860433 vs. TrEMBL
Match: A5I866_SOYBN (Glucosyltransferase OS=Glycine max GN=ugt1 PE=2 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 2.934e-32
Identity = 68/98 (69.39%), Postives = 84/98 (85.71%), Query Frame = 2
Query:    2 VNGVPWVVWPLYAEQKMNAVILTEDVKVGLRPIVNENGLVERQEIASVVKCLMEGEEGKKLRYKMKDLKEAAAKTLGENGTSTKIISKLALKWSNGNN 295
            VNGVP++ WPL+AEQ+ NA +LT DVKV LRP V E+GLVERQEIAS+VKCLMEGE+GKKLRY++KD+KEAAAK L ++G+ST  IS LALKW++  N
Sbjct:  379 VNGVPFIAWPLFAEQRTNAFMLTHDVKVALRPNVAESGLVERQEIASLVKCLMEGEQGKKLRYRIKDIKEAAAKALAQHGSSTTNISNLALKWTHKFN 476          
BLAST of CD860433 vs. TrEMBL
Match: D2KY81_FORIN (UDP-sugar:glycosyltransferase OS=Forsythia intermedia GN=FkUGT7 PE=2 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 1.780e-29
Identity = 67/101 (66.34%), Postives = 81/101 (80.20%), Query Frame = 2
Query:    2 VNGVPWVVWPLYAEQKMNAVILTEDVKVGLRPIVNENGLVERQEIASVVKCLMEGEEGKKLRYKMKDLKEAAAKTLGENGTSTKIISKLALKWSNGNNIST 304
            VNGVP + WPLYAEQ+ NAV+LTEDVKV LRP  NENGLV R EIA VVK LMEGEEGK +R +M+DLK+AAAK L ++G+STK +++L  KW   +NIST
Sbjct:  376 VNGVPLIAWPLYAEQRSNAVMLTEDVKVALRPKFNENGLVTRLEIAKVVKGLMEGEEGKAIRSRMRDLKDAAAKVLSDDGSSTKSLAELCSKWK--SNIST 474          
BLAST of CD860433 vs. TrEMBL
Match: A7M6J9_9ERIC (Glucosyltransferase OS=Cyclamen persicum GN=CpYCy17 PE=2 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 2.325e-29
Identity = 62/95 (65.26%), Postives = 80/95 (84.21%), Query Frame = 2
Query:    2 VNGVPWVVWPLYAEQKMNAVILTEDVKVGLRPIVNENGLVERQEIASVVKCLMEGEEGKKLRYKMKDLKEAAAKTLGENGTSTKIISKLALKWSN 286
            VNGVP + WPLYAEQKMNA +LTEDVKV LRP  ++NGLVER EIA++V+ LMEGE GK+LR +M+DLK+A+AKTL  +G ST+I+++L+ KW N
Sbjct:  376 VNGVPLIAWPLYAEQKMNAAMLTEDVKVALRPKYSKNGLVERTEIATIVRSLMEGEGGKQLRNRMRDLKDASAKTLSTDGESTRILTELSRKWKN 470          
BLAST of CD860433 vs. TrEMBL
Match: B9I8V8_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_731288 PE=3 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 1.507e-28
Identity = 61/95 (64.21%), Postives = 80/95 (84.21%), Query Frame = 2
Query:    2 VNGVPWVVWPLYAEQKMNAVILTEDVKVGLRPIVNENGLVERQEIASVVKCLMEGEEGKKLRYKMKDLKEAAAKTLGENGTSTKIISKLALKWSN 286
            VN VP +VWPLYAEQKMNA +LT+DV+V LRP  +ENGL+ R+EIA++V+ LMEGEEGK++R +MKDLK+AAA+ L E G+STK +S++A KW N
Sbjct:  376 VNAVPLIVWPLYAEQKMNAWMLTKDVEVALRPKASENGLIGREEIANIVRGLMEGEEGKRVRNRMKDLKDAAAEVLSEAGSSTKALSEVARKWKN 470          
BLAST of CD860433 vs. TrEMBL
Match: D7UCM3_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_46.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00027064001 PE=4 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 2.570e-28
Identity = 60/96 (62.50%), Postives = 76/96 (79.17%), Query Frame = 2
Query:    8 GVPWVVWPLYAEQKMNAVILTEDVKVGLRPIVNENGLVERQEIASVVKCLMEGEEGKKLRYKMKDLKEAAAKTLGENGTSTKIISKLALKWSNGNN 295
            GVP + WPLYAEQKMNA+ LT+D+KV LRP VNENGL++R EIA +VK LMEGEEGK +R +MKDLK+A+AK L  +G+STK ++ +A KW    N
Sbjct:  373 GVPMIAWPLYAEQKMNAITLTDDLKVALRPKVNENGLIDRNEIARIVKGLMEGEEGKDVRSRMKDLKDASAKVLSHDGSSTKALATVAQKWKAHKN 468          
BLAST of CD860433 vs. TrEMBL
Match: B6EWZ3_LYCBA (UDP-glucose:glucosyltransferase OS=Lycium barbarum GN=UGT72B10 PE=2 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 3.357e-28
Identity = 62/92 (67.39%), Postives = 78/92 (84.78%), Query Frame = 2
Query:    2 VNGVPWVVWPLYAEQKMNAVILTEDVKVGLRPIVNENGLVERQEIASVVKCLMEGEEGKKLRYKMKDLKEAAAKTLGENGTSTKIISKLALK 277
            V+GVP++ WPLYAEQKMNAV+L+ED+KV LRP  NENG+V R EIA VVK LMEGEEGK +R +M+DLK+AAAK L E+G+STK +++LA K
Sbjct:  377 VHGVPFIAWPLYAEQKMNAVMLSEDIKVALRPKANENGIVGRLEIAKVVKGLMEGEEGKVVRSRMRDLKDAAAKVLSEDGSSTKALAELATK 468          
BLAST of CD860433 vs. TrEMBL
Match: A5C5V2_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_012544 PE=3 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 4.384e-28
Identity = 60/96 (62.50%), Postives = 75/96 (78.12%), Query Frame = 2
Query:    8 GVPWVVWPLYAEQKMNAVILTEDVKVGLRPIVNENGLVERQEIASVVKCLMEGEEGKKLRYKMKDLKEAAAKTLGENGTSTKIISKLALKWSNGNN 295
            GVP + WPLYAEQKMNA+ LT+D+KV LRP VNENGL++R EIA +VK LMEGEEGK +R +MKDLK+A+AK L  +G+STK +  +A KW    N
Sbjct:  360 GVPMIAWPLYAEQKMNAITLTDDLKVALRPKVNENGLIDRNEIARIVKGLMEGEEGKDVRSRMKDLKDASAKVLSHDGSSTKALXTVAQKWKAHKN 455          
BLAST of CD860433 vs. TrEMBL
Match: A7M6J8_9ERIC (Glucosyltransferase OS=Cyclamen persicum GN=CpYCy11 PE=2 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 5.726e-28
Identity = 60/95 (63.16%), Postives = 75/95 (78.95%), Query Frame = 2
Query:    2 VNGVPWVVWPLYAEQKMNAVILTEDVKVGLRPIVNENGLVERQEIASVVKCLMEGEEGKKLRYKMKDLKEAAAKTLGENGTSTKIISKLALKWSN 286
            VNGVP + WPLYAEQKMNAV+LTED+KV LRP  +++GLVER EIA +VK LMEGEEGK+LR +M+DLK  + K L  +G STK++ +L  KW N
Sbjct:  374 VNGVPLIAWPLYAEQKMNAVMLTEDIKVALRPKCSKSGLVERAEIAKIVKSLMEGEEGKRLRSRMRDLKNVSEKRLSADGESTKMLRELTQKWKN 468          
BLAST of CD860433 vs. SwissProt
Match: HQGT_RAUSE (Hydroquinone glucosyltransferase OS=Rauvolfia serpentina GN=AS PE=1 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 7.317e-30
Identity = 62/95 (65.26%), Postives = 76/95 (80.00%), Query Frame = 2
Query:    2 VNGVPWVVWPLYAEQKMNAVILTEDVKVGLRPIVNENGLVERQEIASVVKCLMEGEEGKKLRYKMKDLKEAAAKTLGENGTSTKIISKLALKWSN 286
            VNGVP + WPLYAEQKMNAV+LTE +KV LRP   ENGL+ R EIA+ VK LMEGEEGKK R  MKDLK+AA++ L ++G+STK +++LA KW N
Sbjct:  371 VNGVPLIAWPLYAEQKMNAVMLTEGLKVALRPKAGENGLIGRVEIANAVKGLMEGEEGKKFRSTMKDLKDAASRALSDDGSSTKALAELACKWEN 465          
BLAST of CD860433 vs. SwissProt
Match: HQGT_ARATH (Probable hydroquinone glucosyltransferase OS=Arabidopsis thaliana GN=At4g01070 PE=1 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.380e-28
Identity = 58/93 (62.37%), Postives = 76/93 (81.72%), Query Frame = 2
Query:    2 VNGVPWVVWPLYAEQKMNAVILTEDVKVGLRPIVNENGLVERQEIASVVKCLMEGEEGKKLRYKMKDLKEAAAKTLGENGTSTKIISKLALKW 280
            V+G+P + WPLYAEQKMNAV+L+ED++  LRP   ++GLV R+E+A VVK LMEGEEGK +R KMK+LKEAA + L ++GTSTK +S +ALKW
Sbjct:  375 VSGIPLIAWPLYAEQKMNAVLLSEDIRAALRPRAGDDGLVRREEVARVVKGLMEGEEGKGVRNKMKELKEAACRVLKDDGTSTKALSLVALKW 467          
BLAST of CD860433 vs. SwissProt
Match: UFOG5_MANES (Anthocyanidin 3-O-glucosyltransferase 5 OS=Manihot esculenta GN=GT5 PE=2 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 3.898e-15
Identity = 37/92 (40.22%), Postives = 63/92 (68.48%), Query Frame = 2
Query:    8 GVPWVVWPLYAEQKMNAVILTEDVKVGLRP-IVNENGLVERQEIASVVKCLMEGEEGKKLRYKMKDLKEAAAKTLGENGTSTKIISKLALKW 280
            GVP + WP+YAEQ+MNA +LTE++ V +RP  +    +V+R+EI  +++ +M  EEG ++R ++++LK++  K L E G+S   +S L  +W
Sbjct:  382 GVPIIAWPIYAEQRMNATLLTEELGVAVRPKNLPAKEVVKREEIERMIRRIMVDEEGSEIRKRVRELKDSGEKALNEGGSSFNYMSALGNEW 473          
BLAST of CD860433 vs. SwissProt
Match: ANGLT_ROSHC (Anthocyanidin 5,3-O-glucosyltransferase OS=Rosa hybrid cultivar GN=RhGT1 PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 2.793e-13
Identity = 36/92 (39.13%), Postives = 52/92 (56.52%), Query Frame = 2
Query:    5 NGVPWVVWPLYAEQKMNAVILTEDVKVGLRPIVNENGLVERQEIASVVKCLMEGEEGKKLRYKMKDLKEAAAKTLGENGTSTKIISKLALKW 280
            NGVP V WPLYAEQK+  V L E++KV +    +E G V   E+   V+ LM+ E G ++R ++ +      K   E G+S   ++KLA  W
Sbjct:  379 NGVPMVAWPLYAEQKLGRVFLVEEMKVAVGVKESETGFVSADELEKRVRELMDSESGDEIRGRVSEFSNGGVKAKEEGGSSVASLAKLAQLW 470          
BLAST of CD860433 vs. SwissProt
Match: ZOG_PHALU (Zeatin O-glucosyltransferase OS=Phaseolus lunatus GN=ZOG1 PE=2 SV=1)

HSP 1 Score: 58.9214 bits (141), Expect = 9.299e-9
Identity = 31/82 (37.80%), Postives = 49/82 (59.76%), Query Frame = 2
Query:    8 GVPWVVWPLYAEQKMNAVILTEDVKVGL--RPIVNENGLVERQEIASVVKCLMEGEEGKKLRYKMKDLKEAAAKTLGENGTS 247
            GVP   WP++++Q  NAV++TE +KVGL  +     N LV    + + V+ LME +EG ++R +   LK A  +++ E G S
Sbjct:  365 GVPIATWPMHSDQPRNAVLVTEVLKVGLVVKDWAQRNSLVSASVVENGVRRLMETKEGDEMRQRAVRLKNAIHRSMDEGGVS 446          
BLAST of CD860433 vs. SwissProt
Match: COGT2_ARATH (Cytokinin-O-glucosyltransferase 2 OS=Arabidopsis thaliana GN=UGT85A1 PE=1 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 3.534e-8
Identity = 29/72 (40.28%), Postives = 45/72 (62.50%), Query Frame = 2
Query:    8 GVPWVVWPLYAEQKMNAVILTEDVKVGLRPIVNENGLVERQEIASVVKCLMEGEEGKKLRYKMKDLKEAAAK 223
            GVP V WP +A+Q+MN     ++  VG    +   G V+R+E+ +VV+ LM+GE+GKK+R K  + +  A K
Sbjct:  394 GVPMVCWPFFADQQMNCKFCCDEWDVG----IEIGGDVKREEVEAVVRELMDGEKGKKMREKAVEWQRLAEK 461          
BLAST of CD860433 vs. SwissProt
Match: Y1567_ARATH (Uncharacterized UDP-glucosyltransferase At1g05670 OS=Arabidopsis thaliana GN=At1g05670 PE=2 SV=1)

HSP 1 Score: 56.225 bits (134), Expect = 6.027e-8
Identity = 30/86 (34.88%), Postives = 50/86 (58.14%), Query Frame = 2
Query:    8 GVPWVVWPLYAEQKMNAVILTEDVKVGLRPIVNENGLVERQEIASVVKCLMEGEEGKKLRYKMKDLKEAAAKTLGENGTSTKIISK 265
            GVP +  P +A+Q  NA  + +  KVG+R   + +G V R+E    V+ +ME E+GK++R   +  K  A + + E G+S K I++
Sbjct:  362 GVPMIGMPHWADQPTNAKFMEDVWKVGVRVKADSDGFVRREEFVRRVEEVMEAEQGKEIRKNAEKWKVLAQEAVSEGGSSDKNINE 447          
BLAST of CD860433 vs. SwissProt
Match: IABG1_ARATH (Indole-3-acetate beta-glucosyltransferase 1 OS=Arabidopsis thaliana GN=UGT75B1 PE=1 SV=1)

HSP 1 Score: 56.225 bits (134), Expect = 6.027e-8
Identity = 34/84 (40.48%), Postives = 50/84 (59.52%), Query Frame = 2
Query:    2 VNGVPWVVWPLYAEQKMNAVILTEDVKVGLRPIVNENGLVERQEIASVVKCLMEGEEGKKLRYKMKDLKEAAAKTLGENGTSTK 253
            V GVP V +P++++Q  NA +L E  K G+R   N++GLVER EI   ++ +ME E+  +LR   K  K  A +   E G+S K
Sbjct:  360 VLGVPVVAFPMWSDQPTNAKLLEESWKTGVRVRENKDGLVERGEIRRCLEAVME-EKSVELRENAKKWKRLAMEAGREGGSSDK 442          
BLAST of CD860433 vs. SwissProt
Match: ANGT_GENTR (Anthocyanin 3'-O-beta-glucosyltransferase OS=Gentiana triflora PE=1 SV=1)

HSP 1 Score: 55.0694 bits (131), Expect = 1.343e-7
Identity = 33/100 (33.00%), Postives = 54/100 (54.00%), Query Frame = 2
Query:    8 GVPWVVWPLYAEQKMNAVILTEDVKVGLRP-------IVNENGLVERQEIASVVKCLMEGEEGKKLRYKMKDLKEAAAKTLGENGTSTKIISKLALKWSN 286
            GV  V WPL+AEQ  N  ++T+ ++ G+         +     +V+R+ I+  V+ LM  EEG  +R + K LKE A K +   G+S   +S L ++ S+
Sbjct:  379 GVAMVTWPLFAEQFYNEKLMTDILRTGVSVGSLQWSRVTTSAVVVKRESISKAVRRLMAEEEGVDIRNRAKALKEKAKKAVEGGGSSYSDLSALLVELSS 478          
BLAST of CD860433 vs. SwissProt
Match: CNGT2_ARATH (Cytokinin-N-glucosyltransferase 2 OS=Arabidopsis thaliana GN=UGT76C2 PE=1 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 2.991e-7
Identity = 30/88 (34.09%), Postives = 52/88 (59.09%), Query Frame = 2
Query:    8 GVPWVVWPLYAEQKMNAVILTEDVKVGLRPIVNENGLVERQEIASVVKCLMEGEEGKKLRYKMKDLKEAAAKTLGENGTSTKIISKLA 271
            GVP +  P   +Q +N+  +++  K+G    ++  G +E++EI   V+ LME  EG K+R +MK LK+   K++ + G+S + I  LA
Sbjct:  361 GVPMICLPGGWDQMLNSRFVSDIWKIG----IHLEGRIEKKEIEKAVRVLMEESEGNKIRERMKVLKDEVEKSVKQGGSSFQSIETLA 444          
BLAST of CD860433 vs. TAIR peptide
Match: AT4G01070.1 (| Symbols: GT72B1, UGT72B1 | UDP-Glycosyltransferase superfamily protein | chr4:461858-463300 REVERSE LENGTH=480)

HSP 1 Score: 124.79 bits (312), Expect = 1.094e-29
Identity = 58/93 (62.37%), Postives = 76/93 (81.72%), Query Frame = 2
Query:    2 VNGVPWVVWPLYAEQKMNAVILTEDVKVGLRPIVNENGLVERQEIASVVKCLMEGEEGKKLRYKMKDLKEAAAKTLGENGTSTKIISKLALKW 280
            V+G+P + WPLYAEQKMNAV+L+ED++  LRP   ++GLV R+E+A VVK LMEGEEGK +R KMK+LKEAA + L ++GTSTK +S +ALKW
Sbjct:  375 VSGIPLIAWPLYAEQKMNAVLLSEDIRAALRPRAGDDGLVRREEVARVVKGLMEGEEGKGVRNKMKELKEAACRVLKDDGTSTKALSLVALKW 467          
BLAST of CD860433 vs. TAIR peptide
Match: AT1G01390.1 (| Symbols: | UDP-Glycosyltransferase superfamily protein | chr1:148319-149761 REVERSE LENGTH=480)

HSP 1 Score: 106.686 bits (265), Expect = 3.084e-24
Identity = 49/93 (52.69%), Postives = 66/93 (70.97%), Query Frame = 2
Query:    2 VNGVPWVVWPLYAEQKMNAVILTEDVKVGLRPIVNENGLVERQEIASVVKCLMEGEEGKKLRYKMKDLKEAAAKTLGENGTSTKIISKLALKW 280
            VNGVP + WPL+AEQKMN ++L EDV   LR    E+G+V R+E+  VVK LMEGEEGK +  K+K+LKE   + LG++G S+K   ++ LKW
Sbjct:  375 VNGVPLIAWPLFAEQKMNTLLLVEDVGAALRIHAGEDGIVRREEVVRVVKALMEGEEGKAIGNKVKELKEGVVRVLGDDGLSSKSFGEVLLKW 467          
BLAST of CD860433 vs. TAIR peptide
Match: AT1G01420.1 (| Symbols: UGT72B3 | UDP-glucosyl transferase 72B3 | chr1:154566-156011 REVERSE LENGTH=481)

HSP 1 Score: 104.375 bits (259), Expect = 1.531e-23
Identity = 51/93 (54.84%), Postives = 71/93 (76.34%), Query Frame = 2
Query:    2 VNGVPWVVWPLYAEQKMNAVILTEDVKVGLRPIVNENGLVERQEIASVVKCLMEGEEGKKLRYKMKDLKEAAAKTLGENGTSTKIISKLALKW 280
            VNGVP + WPLYAEQKMNA++L  DV   LR  + E+G+V R+E+A VVK L+EGEEG  +R KMK+LKE + + L ++G STK +++++LKW
Sbjct:  375 VNGVPLIAWPLYAEQKMNALLLV-DVGAALRARLGEDGVVGREEVARVVKGLIEGEEGNAVRKKMKELKEGSVRVLRDDGFSTKSLNEVSLKW 466          
BLAST of CD860433 vs. TAIR peptide
Match: AT4G36770.1 (| Symbols: | UDP-Glycosyltransferase superfamily protein | chr4:17330217-17331590 REVERSE LENGTH=457)

HSP 1 Score: 73.559 bits (179), Expect = 2.893e-14
Identity = 36/76 (47.37%), Postives = 58/76 (76.32%), Query Frame = 2
Query:    2 VNGVPWVVWPLYAEQKMNAVILTEDVKVGLRPIVNENGLVERQEIASVVKCLMEGEEGKKLRYKMKDLKEAAAKTL 229
            VNGVP V WPLY+EQKMNA +++ ++K+ L+ I   +G+V+++ IA +VK +M+ EEGK++R  +K+LK+ A + L
Sbjct:  372 VNGVPMVAWPLYSEQKMNARMVSGELKIALQ-INVADGIVKKEVIAEMVKRVMDEEEGKEMRKNVKELKKTAEEAL 446          
BLAST of CD860433 vs. TAIR peptide
Match: AT3G50740.1 (| Symbols: UGT72E1 | UDP-glucosyl transferase 72E1 | chr3:18855348-18856811 REVERSE LENGTH=487)

HSP 1 Score: 72.7886 bits (177), Expect = 4.935e-14
Identity = 38/92 (41.30%), Postives = 62/92 (67.39%), Query Frame = 2
Query:    2 VNGVPWVVWPLYAEQKMNAVILTEDVKVGLR-PIVNENGLVERQEIASVVKCLMEGEEGKKLRYKMKDLKEAAAKTLG-ENGTSTKIISKLA 271
            V GVP + WPL+AEQ MNA +L E++ V +R   +   G++ R EI ++V+ +M  EEG ++R K+K LKE AA++L  + G + + +S++A
Sbjct:  379 VGGVPMIAWPLFAEQMMNATLLNEELGVAVRSKKLPSEGVITRAEIEALVRKIMVEEEGAEMRKKIKKLKETAAESLSCDGGVAHESLSRIA 470          
BLAST of CD860433 vs. TAIR peptide
Match: AT1G10400.1 (| Symbols: | UDP-Glycosyltransferase superfamily protein | chr1:3414869-3416358 REVERSE LENGTH=467)

HSP 1 Score: 68.1662 bits (165), Expect = 1.216e-12
Identity = 38/93 (40.86%), Postives = 59/93 (63.44%), Query Frame = 2
Query:   11 VPWVVWPLYAEQKMNAVILTEDVKVGLRPIVNENGLVERQEIASVVKCLMEGEEGKKLRYKMKDLKEAAAKTLGEN-GTSTKIISKLALKWSN 286
            VP + +PL AEQ +NA+++ E+++V  R +    G+V R+EIA  VK LMEGE+GK+LR  ++   + A K L E  G+S K +  L  ++ N
Sbjct:  372 VPILAFPLAAEQPLNAILVVEELRVAERVVAASEGVVRREEIAEKVKELMEGEKGKELRRNVEAYGKMAKKALEEGIGSSRKNLDNLINEFCN 464          
BLAST of CD860433 vs. TAIR peptide
Match: AT2G18570.1 (| Symbols: | UDP-Glycosyltransferase superfamily protein | chr2:8063429-8064841 FORWARD LENGTH=470)

HSP 1 Score: 65.855 bits (159), Expect = 6.033e-12
Identity = 33/83 (39.76%), Postives = 58/83 (69.88%), Query Frame = 2
Query:    8 GVPWVVWPLYAEQKMNAVILTEDVKVGLRPI-VNENGLVERQEIASVVKCLM--EGEEGKKLRYKMKDLKEAAAKTLGENGTS 247
            GVP + WPLYAEQ MNA +LTE++ V +R   +    ++ R+E+AS+V+ +M  E EEG+K+R K ++++ ++ +   ++G+S
Sbjct:  373 GVPIIAWPLYAEQWMNATLLTEEIGVAVRTSELPSERVIGREEVASLVRKIMAEEDEEGQKIRAKAEEVRVSSERAWSKDGSS 455          
BLAST of CD860433 vs. TAIR peptide
Match: AT5G14860.1 (| Symbols: | UDP-Glycosyltransferase superfamily protein | chr5:4805887-4807759 FORWARD LENGTH=492)

HSP 1 Score: 63.929 bits (154), Expect = 2.292e-11
Identity = 35/91 (38.46%), Postives = 55/91 (60.44%), Query Frame = 2
Query:    8 GVPWVVWPLYAEQKMNAVILTEDVKVGLR---PIVNENGLVERQEIASVVKCLMEGEEGKKLRYKMKDLKEAAAKTLGE-NGTSTKIISKL 268
            GVP + WP+ AEQ +NA ++ E++K+G+R     V+  G V R+E++  VK LMEGE GK     +K+  + A K + +  G+S K +  L
Sbjct:  381 GVPLLAWPMMAEQPLNAKLVVEELKIGVRIETEDVSVKGFVTREELSRKVKQLMEGEMGKTTMKNVKEYAKMAKKAMAQGTGSSWKSLDSL 471          
BLAST of CD860433 vs. TAIR peptide
Match: AT2G16890.2 (| Symbols: | UDP-Glycosyltransferase superfamily protein | chr2:7316938-7319022 FORWARD LENGTH=478)

HSP 1 Score: 63.5438 bits (153), Expect = 2.994e-11
Identity = 35/86 (40.70%), Postives = 52/86 (60.47%), Query Frame = 2
Query:    8 GVPWVVWPLYAEQKMNAVILTEDVKVGLRPIVNE---NGLVERQEIASVVKCLMEGEEGKKLRYKMKDLKEAAAKTLGE-NGTSTK 253
            GVP + WP+ AEQ +NA ++ E++KVG+R    +    G V R+E++  +K LMEGE GK  R  +K+  + A   L E  G+S K
Sbjct:  373 GVPLLAWPMMAEQPLNAKMVVEEIKVGVRVETEDGSVKGFVTREELSGKIKELMEGETGKTARKNVKEYSKMAKAALVEGTGSSWK 458          
BLAST of CD860433 vs. TAIR peptide
Match: AT2G18560.1 (| Symbols: | UDP-Glycosyltransferase superfamily protein | chr2:8059696-8060838 FORWARD LENGTH=380)

HSP 1 Score: 61.6178 bits (148), Expect = 1.138e-10
Identity = 30/83 (36.14%), Postives = 56/83 (67.47%), Query Frame = 2
Query:    8 GVPWVVWPLYAEQKMNAVILTEDVKVGLRPI-VNENGLVERQEIASVVKCLM--EGEEGKKLRYKMKDLKEAAAKTLGENGTS 247
            GVP + WPLYAEQ MNA +LTE++ + +R   +    ++ R+E+AS+VK ++  E +EG+K++ K ++++ ++ +     G+S
Sbjct:  283 GVPIIAWPLYAEQWMNATLLTEEIGMAIRTSELPSKKVISREEVASLVKKIVAEEDKEGRKIKTKAEEVRVSSERAWTHGGSS 365          
The following BLAST results are available for this feature:
BLAST of CD860433 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
B7FM23_MEDTR2.927e-4084.85Putative uncharacterized protein OS=Medicago trunc... [more]
A4F1R9_CLITE6.748e-3778.00Putative glycosyltransferase OS=Clitoria ternatea ... [more]
A5I866_SOYBN2.934e-3269.39Glucosyltransferase OS=Glycine max GN=ugt1 PE=2 SV... [more]
D2KY81_FORIN1.780e-2966.34UDP-sugar:glycosyltransferase OS=Forsythia interme... [more]
A7M6J9_9ERIC2.325e-2965.26Glucosyltransferase OS=Cyclamen persicum GN=CpYCy1... [more]
B9I8V8_POPTR1.507e-2864.21Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
D7UCM3_VITVI2.570e-2862.50Whole genome shotgun sequence of line PN40024, sca... [more]
B6EWZ3_LYCBA3.357e-2867.39UDP-glucose:glucosyltransferase OS=Lycium barbarum... [more]
A5C5V2_VITVI4.384e-2862.50Putative uncharacterized protein OS=Vitis vinifera... [more]
A7M6J8_9ERIC5.726e-2863.16Glucosyltransferase OS=Cyclamen persicum GN=CpYCy1... [more]
back to top
BLAST of CD860433 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Swissprot)
Total hits: 10
Match NameE-valueIdentityDescription
HQGT_RAUSE7.317e-3065.26Hydroquinone glucosyltransferase OS=Rauvolfia serp... [more]
HQGT_ARATH1.380e-2862.37Probable hydroquinone glucosyltransferase OS=Arabi... [more]
UFOG5_MANES3.898e-1540.22Anthocyanidin 3-O-glucosyltransferase 5 OS=Manihot... [more]
ANGLT_ROSHC2.793e-1339.13Anthocyanidin 5,3-O-glucosyltransferase OS=Rosa hy... [more]
ZOG_PHALU9.299e-937.80Zeatin O-glucosyltransferase OS=Phaseolus lunatus ... [more]
COGT2_ARATH3.534e-840.28Cytokinin-O-glucosyltransferase 2 OS=Arabidopsis t... [more]
Y1567_ARATH6.027e-834.88Uncharacterized UDP-glucosyltransferase At1g05670 ... [more]
IABG1_ARATH6.027e-840.48Indole-3-acetate beta-glucosyltransferase 1 OS=Ara... [more]
ANGT_GENTR1.343e-733.00Anthocyanin 3'-O-beta-glucosyltransferase OS=Genti... [more]
CNGT2_ARATH2.991e-734.09Cytokinin-N-glucosyltransferase 2 OS=Arabidopsis t... [more]
back to top
BLAST of CD860433 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide)
Total hits: 10
Match NameE-valueIdentityDescription
AT4G01070.11.094e-2962.37| Symbols: GT72B1, UGT72B1 | UDP-Glycosyltransfera... [more]
AT1G01390.13.084e-2452.69| Symbols: | UDP-Glycosyltransferase superfamily ... [more]
AT1G01420.11.531e-2354.84| Symbols: UGT72B3 | UDP-glucosyl transferase 72B3... [more]
AT4G36770.12.893e-1447.37| Symbols: | UDP-Glycosyltransferase superfamily ... [more]
AT3G50740.14.935e-1441.30| Symbols: UGT72E1 | UDP-glucosyl transferase 72E1... [more]
AT1G10400.11.216e-1240.86| Symbols: | UDP-Glycosyltransferase superfamily ... [more]
AT2G18570.16.033e-1239.76| Symbols: | UDP-Glycosyltransferase superfamily ... [more]
AT5G14860.12.292e-1138.46| Symbols: | UDP-Glycosyltransferase superfamily ... [more]
AT2G16890.22.994e-1140.70| Symbols: | UDP-Glycosyltransferase superfamily ... [more]
AT2G18560.11.138e-1036.14| Symbols: | UDP-Glycosyltransferase superfamily ... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002213UDP-glucuronosyl/UDP-glucosyltransferasePANTHERPTHR11926GLUCOSYL/GLUCURONOSYL TRANSFERASEScoord: 1..31
score: 1.8
NoneNo IPR availableGENE3D3.40.50.2000no descriptioncoord: 2..70
score: 0.
NoneNo IPR availablePANTHERPTHR11926:SF15UDP-GLUCOSYLTRANSFERASEcoord: 1..31
score: 1.8

Properties
Property NameValue
Singlet in analysisPisum sativum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>CD860433 ID=CD860433|Name=CD860433|organism=Pisum sativum|type=EST|length=331bp
TGTGAATGGGGTGCCTTGGGTTGTTTGGCCACTCTACGCTGAACAAAAAA
TGAATGCTGTTATATTAACCGAGGATGTTAAGGTTGGGTTGAGACCAATT
GTTAATGAGAATGGTTTGGTTGAGAGACAAGAAATTGCTAGTGTTGTCAA
GTGTTTGATGGAAGGTGAAGAAGGGAAGAAGCTTCGTTATAAAATGAAGG
ATCTTAAAGAGGCTGCTGCAAAAACTTTGGGTGAAAATGGAACTTCCACA
AAAATCATCTCTAAGTTGGCTCTCAAATGGAGCAATGGCAACAACATTTC
CACTTTGACAAATTAAATTATTAAGTATTAG
back to top
Annotated Terms
The following terms have been associated with this EST:
Vocabulary: Biological Process
TermDefinition
GO:0008152metabolic process
Vocabulary: INTERPRO
TermDefinition
IPR002213UDP_glucos_trans