FG531407
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FG531407 vs. TrEMBL
Match: B9HK89_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_765080 PE=4 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 7.456e-12 Identity = 35/56 (62.50%), Postives = 41/56 (73.21%), Query Frame = 1 Query: 166 CFPSTPKKLAMTIACSLSGAVVLAVGMHLSYVNVEPQRARTMARDKLVLDTLRKKY 333 CFPSTPKKLAMTI SGA + A+G+H YVN+ PQRAR AR+ V + LRKKY Sbjct: 4 CFPSTPKKLAMTIGLFASGAALFALGLHKCYVNIAPQRARIEARNDFVRERLRKKY 59
BLAST of FG531407 vs. TrEMBL
Match: D7MF66_ARALY (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_913883 PE=4 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 2.833e-11 Identity = 32/57 (56.14%), Postives = 44/57 (77.19%), Query Frame = 1 Query: 166 CFPSTPKKLAMTIACSLSGAVVLAVGMHLSYVNVEPQRARTMARDKLVLDTLRKKYG 336 C+PS+P+KLAMT+A SGA + A+G+H SY+NV PQ+ART AR+ V + LR+K G Sbjct: 4 CYPSSPRKLAMTVAFFASGAALFAIGIHFSYLNVAPQQARTKARNDFVKERLRQKQG 60
BLAST of FG531407 vs. TrEMBL
Match: B9RQ48_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_0954980 PE=4 SV=1) HSP 1 Score: 58.151 bits (139), Expect = 3.242e-7 Identity = 27/49 (55.10%), Postives = 36/49 (73.47%), Query Frame = 1 Query: 190 LAMTIACSLSGAVVLAVGMHLSYVNVEPQRARTMARDKLVLDTLRKKYG 336 +AMT+ C ++GA + AVG LSYVNV PQ+AR AR+ V + LRKK+G Sbjct: 1 MAMTVGCFVAGAALFAVGSRLSYVNVAPQQARIKARNDFVKERLRKKHG 49 The following BLAST results are available for this feature:
BLAST of FG531407 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FG531407 ID=FG531407; Name=FG531407; organism=Pisum sativum; type=EST; length=361bpback to top |