GH719951

EST Overview
NameGH719951
Unique NameGH719951
TypeEST
OrganismPisum sativum (pea)
Sequence length632
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
Pisum sativum unigene v12010-12-27
Homology Analysis: Pisum sativum unigene v1 vs Trembl2010-12-28
Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide2011-02-03
InterProScan analysis for Pisum sativum unigene v12010-12-29
Libraries
Library NameType
LIBEST_024269 TNIcdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Pisum sativum unigene v1Pisum sativum unigene v1EST
Homology
BLAST of GH719951 vs. TrEMBL
Match: Q1SKV9_MEDTR (Bromodomain OS=Medicago truncatula GN=MtrDRAFT_AC140550g39v2 PE=4 SV=2)

HSP 1 Score: 169.474 bits (428), Expect = 1.877e-40
Identity = 96/166 (57.83%), Postives = 105/166 (63.25%), Query Frame = -3
Query:  154 GDADEDKGDVTKMEPSEKQRSPFEGRHEVNEVNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKRRID------GTLAEKSELGDTTGLHDEYK-AQLEGPTAEFQQLKKHKEPQNSHQKAKLLESFYSENPMLSSLCGTLFPENSQSVWSGPHSLIRQR 630
            GD D+DKG+VTKME SEK  SP +GRHEVNEV+                                    KRR+D      GTLAE+SE+GDT  LHDEYK  Q EG  A  QQ KKHKEPQ+ HQKAKLLES  SENPMLSSLCGTLFP+NSQSVWSGPHSLI QR
Sbjct:  410 GDVDDDKGEVTKMETSEKNCSPSDGRHEVNEVDDDGMEEENHGPEDVEEDEEEDGEGENEEEIEMNRV-KRRMDETLRHGGTLAEESEVGDTAALHDEYKNTQQEGQAAVVQQQKKHKEPQDKHQKAKLLESLCSENPMLSSLCGTLFPKNSQSVWSGPHSLIHQR 574          
BLAST of GH719951 vs. TrEMBL
Match: C6T105_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 3.549e-31
Identity = 81/163 (49.69%), Postives = 92/163 (56.44%), Query Frame = -3
Query:  151 GDADEDKGDVTKMEPSEKQRSPFEGRHEVNEVNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKRRID--GTLAEKSELGDTTGLHDEYKA-QLEGPTAEFQQLKKHKEPQNSHQKAKLLESFYSENPMLSSLCGTLFPENSQSVWSGPHSLIRQRN 630
            GD DEDKG+V KME SEKQ SP E +H   +V+                                       +   GTL EKS +GD T LHDEY+  Q EG  A  QQ KKHK  Q+  QKAKLLES YSEN  LSSLCG LFP+NSQSVWSGPHSLI++RN
Sbjct:    5 GDVDEDKGEVAKMEISEKQCSPSERKHVSIDVDNDDDNDDHGLEEGEEEENGEEEDEEEIEMNSQKGEMNETLKHGGTLEEKSNVGDATALHDEYRTKQQEGQFAAVQQQKKHKGSQDKQQKAKLLESLYSENHKLSSLCGILFPQNSQSVWSGPHSLIQKRN 167          
BLAST of GH719951 vs. TrEMBL
Match: C6TCB1_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 1.033e-30
Identity = 80/163 (49.08%), Postives = 91/163 (55.83%), Query Frame = -3
Query:  151 GDADEDKGDVTKMEPSEKQRSPFEGRHEVNEVNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKRRID--GTLAEKSELGDTTGLHDEYKA-QLEGPTAEFQQLKKHKEPQNSHQKAKLLESFYSENPMLSSLCGTLFPENSQSVWSGPHSLIRQRN 630
            GD DEDKG+V KME SEKQ SP E +H   +V+                                       +   GTL EKS +GD T LHDEY+  Q EG  A  QQ KKHK  Q+  QK KLLES YSEN  LSSLCG LFP+NSQSVWSGPHSLI++RN
Sbjct:    5 GDVDEDKGEVAKMEISEKQCSPSERKHVSIDVDNDDDNDDHGLEEGEEEENGEEEDEEEIEMNSQKGEMNETLKHGGTLEEKSNVGDATALHDEYRTKQQEGQFAAVQQQKKHKGSQDKQQKVKLLESLYSENHKLSSLCGILFPQNSQSVWSGPHSLIQKRN 167          
BLAST of GH719951 vs. TrEMBL
Match: B9N0D4_POPTR (Putative uncharacterized protein OS=Populus trichocarpa GN=POPTRDRAFT_596737 PE=4 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 3.123e-11
Identity = 34/70 (48.57%), Postives = 46/70 (65.71%), Query Frame = -3
Query:  151 DEYKAQLEGPTAEFQQLKKHKEPQNSHQKAKLLESFYSENPMLSSLCGTLFPENSQSVWSGPHSLIRQRN 360
            D    Q E   A  Q  +K +E Q   +K K+ + FY ENP+L SLCGTLFP+N +SVWSGPHSL++ ++
Sbjct:   46 DALVLQEEETMAVQQNKRKLQELQEREEKVKVFKKFYIENPLLLSLCGTLFPDNQRSVWSGPHSLVQHQD 115          
BLAST of GH719951 vs. TrEMBL
Match: B9SKD5_RICCO (Bromodomain-containing protein, putative OS=Ricinus communis GN=RCOM_0759490 PE=4 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.550e-10
Identity = 37/81 (45.68%), Postives = 48/81 (59.26%), Query Frame = -3
Query:  103 QLEGPTAEFQQLKKHKEPQNSHQKAKLLESFYSENPMLSSLCGTLFPENSQSVWSGPHSLIRQRNXXXXXXXXXXXXSLMK 345
            Q E  TA F +  K+K+ Q   QKA++ E F   NPML SLC TLFP+N +SVWSGPHSL+ ++             +LMK
Sbjct:  490 QHEDETAAFHR-NKNKDSQERQQKAEMFEKFCPHNPMLLSLCQTLFPDNRRSVWSGPHSLVPRQGSAHGNSIGAAIETLMK 569          
BLAST of GH719951 vs. TrEMBL
Match: A5BQU7_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_008346 PE=4 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 7.201e-8
Identity = 37/101 (36.63%), Postives = 53/101 (52.48%), Query Frame = -3
Query:  160 DGTLAEKSELGDTTGLHDEYKAQLEGPTAEFQQLKKHKEPQNSH----------------QKAKLLESFY-SENPMLSSLCGTLFPENSQSVWSGPHSLIR 411
            +G  +E+S+LGD TG  ++  +Q     AE   + K KE ++                  +K K+ + F  +ENPML  LCGTLFP N  S WS PHSL++
Sbjct: 1135 EGETSEQSQLGDRTG--EDPNSQTPTQIAESGAIPKKKEEKSVQNEEEAAAAEQQKRKMDEKTKMYKEFLQAENPMLLELCGTLFPNNRSSAWSRPHSLVQ 1233          
BLAST of GH719951 vs. TrEMBL
Match: D7KYL8_ARALY (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_475462 PE=4 SV=1)

HSP 1 Score: 59.6918 bits (143), Expect = 2.095e-7
Identity = 32/78 (41.03%), Postives = 43/78 (55.13%), Query Frame = -3
Query:  151 AQLEGPTA----------EFQQLKKHKEPQNSHQKAKLLESFYSENPMLSSLCGTLFP--ENSQSVWSGPHSLIRQRN 348
            A +EGP +          + Q+ KK +E +    + K+ E F   NP L SLC TLFP  +N  SVW+GPHSL + RN
Sbjct:  493 ASIEGPKSTHKDEEEKEKQLQEQKKRQELERKEWRMKMQEKFEVRNPQLLSLCETLFPKDDNHNSVWNGPHSLFKYRN 570          
BLAST of GH719951 vs. TrEMBL
Match: D7KYK0_ARALY (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_475449 PE=4 SV=1)

HSP 1 Score: 58.5362 bits (140), Expect = 4.667e-7
Identity = 32/77 (41.56%), Postives = 42/77 (54.55%), Query Frame = -3
Query:  154 AQLEGPTA----------EFQQLKKHKEPQNSHQKAKLLESFYSENPMLSSLCGTLFP--ENSQSVWSGPHSLIRQR 348
            A LEGP +          + Q+ KK +E +    + K+ E F   NP L SLC TLFP   N  SVW+GPHSL ++R
Sbjct:  490 ASLEGPKSTQNEEEEKEKQLQEQKKRQELERKEWRIKMQEKFQVRNPQLLSLCETLFPNENNHNSVWNGPHSLFKRR 566          
BLAST of GH719951 vs. TrEMBL
Match: Q9C6G1_ARATH (Putative uncharacterized protein T15M6.22 OS=Arabidopsis thaliana GN=At1g58025 PE=1 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 7.961e-7
Identity = 33/77 (42.86%), Postives = 40/77 (51.95%), Query Frame = -3
Query:  154 AQLEGPTA----------EFQQLKKHKEPQNSHQKAKLLESFYSENPMLSSLCGTLFP--ENSQSVWSGPHSLIRQR 348
            A LEGP +            Q+ KK  E +    + K+ E F   NP L SLC TLFP   N  SVW+GPHSL R+R
Sbjct:  479 ASLEGPKSTQNEEEEKEKRLQEQKKRLELERKEWRMKMQEKFQVRNPQLLSLCETLFPNDNNHNSVWNGPHSLFRRR 555          
BLAST of GH719951 vs. TrEMBL
Match: Q0WVD0_ARATH (Putative uncharacterized protein OS=Arabidopsis thaliana PE=2 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 7.961e-7
Identity = 33/77 (42.86%), Postives = 40/77 (51.95%), Query Frame = -3
Query:  154 AQLEGPTA----------EFQQLKKHKEPQNSHQKAKLLESFYSENPMLSSLCGTLFP--ENSQSVWSGPHSLIRQR 348
            A LEGP +            Q+ KK  E +    + K+ E F   NP L SLC TLFP   N  SVW+GPHSL R+R
Sbjct:  183 ASLEGPKSTQNEEEEKEKRLQEQKKRLELERKEWRMKMQEKFQVRNPQLLSLCETLFPNDNNHNSVWNGPHSLFRRR 259          
BLAST of GH719951 vs. TAIR peptide
Match: AT1G58025.3 (| Symbols: | DNA-binding bromodomain-containing protein | chr1:21458219-21461757 REVERSE LENGTH=573)

HSP 1 Score: 57.7658 bits (138), Expect = 5.731e-9
Identity = 33/77 (42.86%), Postives = 40/77 (51.95%), Query Frame = -3
Query:  154 AQLEGPTA----------EFQQLKKHKEPQNSHQKAKLLESFYSENPMLSSLCGTLFP--ENSQSVWSGPHSLIRQR 348
            A LEGP +            Q+ KK  E +    + K+ E F   NP L SLC TLFP   N  SVW+GPHSL R+R
Sbjct:  479 ASLEGPKSTQNEEEEKEKRLQEQKKRLELERKEWRMKMQEKFQVRNPQLLSLCETLFPNDNNHNSVWNGPHSLFRRR 555          
BLAST of GH719951 vs. TAIR peptide
Match: AT1G58025.2 (| Symbols: | DNA-binding bromodomain-containing protein | chr1:21457755-21461757 REVERSE LENGTH=582)

HSP 1 Score: 57.7658 bits (138), Expect = 5.731e-9
Identity = 33/77 (42.86%), Postives = 40/77 (51.95%), Query Frame = -3
Query:  154 AQLEGPTA----------EFQQLKKHKEPQNSHQKAKLLESFYSENPMLSSLCGTLFP--ENSQSVWSGPHSLIRQR 348
            A LEGP +            Q+ KK  E +    + K+ E F   NP L SLC TLFP   N  SVW+GPHSL R+R
Sbjct:  479 ASLEGPKSTQNEEEEKEKRLQEQKKRLELERKEWRMKMQEKFQVRNPQLLSLCETLFPNDNNHNSVWNGPHSLFRRR 555          
BLAST of GH719951 vs. TAIR peptide
Match: AT1G58025.1 (| Symbols: | DNA-binding bromodomain-containing protein | chr1:21458219-21461757 REVERSE LENGTH=572)

HSP 1 Score: 57.7658 bits (138), Expect = 5.731e-9
Identity = 33/77 (42.86%), Postives = 40/77 (51.95%), Query Frame = -3
Query:  154 AQLEGPTA----------EFQQLKKHKEPQNSHQKAKLLESFYSENPMLSSLCGTLFP--ENSQSVWSGPHSLIRQR 348
            A LEGP +            Q+ KK  E +    + K+ E F   NP L SLC TLFP   N  SVW+GPHSL R+R
Sbjct:  478 ASLEGPKSTQNEEEEKEKRLQEQKKRLELERKEWRMKMQEKFQVRNPQLLSLCETLFPNDNNHNSVWNGPHSLFRRR 554          
The following BLAST results are available for this feature:
BLAST of GH719951 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
Q1SKV9_MEDTR1.877e-4057.83Bromodomain OS=Medicago truncatula GN=MtrDRAFT_AC1... [more]
C6T105_SOYBN3.549e-3149.69Putative uncharacterized protein OS=Glycine max PE... [more]
C6TCB1_SOYBN1.033e-3049.08Putative uncharacterized protein OS=Glycine max PE... [more]
B9N0D4_POPTR3.123e-1148.57Putative uncharacterized protein OS=Populus tricho... [more]
B9SKD5_RICCO1.550e-1045.68Bromodomain-containing protein, putative OS=Ricinu... [more]
A5BQU7_VITVI7.201e-836.63Putative uncharacterized protein OS=Vitis vinifera... [more]
D7KYL8_ARALY2.095e-741.03Putative uncharacterized protein OS=Arabidopsis ly... [more]
D7KYK0_ARALY4.667e-741.56Putative uncharacterized protein OS=Arabidopsis ly... [more]
Q9C6G1_ARATH7.961e-742.86Putative uncharacterized protein T15M6.22 OS=Arabi... [more]
Q0WVD0_ARATH7.961e-742.86Putative uncharacterized protein OS=Arabidopsis th... [more]
back to top
BLAST of GH719951 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide)
Total hits: 3
Match NameE-valueIdentityDescription
AT1G58025.35.731e-942.86| Symbols: | DNA-binding bromodomain-containing p... [more]
AT1G58025.25.731e-942.86| Symbols: | DNA-binding bromodomain-containing p... [more]
AT1G58025.15.731e-942.86| Symbols: | DNA-binding bromodomain-containing p... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSEGsegsegcoord: 34..49
score: NAcoord: 69..85
score
NoneNo IPR availableSEGsegsegcoord: 15..62
score
NoneNo IPR availableSEGsegsegcoord: 44..74
score
NoneNo IPR availableSEGsegsegcoord: 34..69
score: NAcoord: 161..173
score
NoneNo IPR availableSEGsegsegcoord: 6..15
score

Properties
Property NameValue
Singlet in analysisPisum sativum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>GH719951 ID=GH719951|Name=GH719951|organism=Pisum sativum|type=EST|length=632bp
TTTTAACAATGAAGGCCATCAACAACAACACTAAAATCTGTCAAGAAAAA
ATCTACAGCATTAATTGGAAGAAGTAGTGAATCCATTAAAATAGGACAAC
TACTTCATGAGCGACCTAATAGCCGCGTGGATTGAACTACTGCGAGCCGA
ATTTCTTTGACGTATTAGCGAGTGCGGACCACTCCACACAGATTGACTGT
TTTCGGGGAAGAGAGTTCCACATAAACTTGAAAGCATGGGATTTTCAGAA
TAAAAGCTCTCAAGTAACTTAGCTTTTTGATGGCTATTTTGGGGTTCCTT
GTGCTTCTTGAGTTGTTGGAACTCAGCAGTTGGTCCTTCTAGTTGCGCTT
TATATTCATCATGAAGACCGGTTGTGTCTCCAAGTTCCGATTTCTCTGCC
AAGGTTCCATCTATCCGTCTCTTCTCACTGTCCATTTCAATCTCTTCCTC
ATCTTCTCCCTCTTCATCTTCCTCCTCTTCTTCATTCTCTGGGCCACGGT
CATCTTCCTTCATCCCATCATCATCGTCATCGTTAACTTCATTGACCTCA
TGTCTTCCCTCAAAAGGGCTGCGTTGCTTCTCGCTAGGCTCCATCTTTGT
CACGTCTCCTTTGTCTTCGTCAGCATCTCCGT
back to top