GH720003

EST Overview
NameGH720003
Unique NameGH720003
TypeEST
OrganismPisum sativum (pea)
Sequence length459
Libraries
Library NameType
LIBEST_024269 TNIcdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Pisum sativum unigene v1Pisum sativum unigene v1EST
Homology
BLAST of GH720003 vs. TrEMBL
Match: B9RYZ1_RICCO (60S ribosomal protein L9, putative OS=Ricinus communis GN=RCOM_1315040 PE=4 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 1.855e-39
Identity = 83/90 (92.22%), Postives = 88/90 (97.78%), Query Frame = -3
Query:  170 INASITNSNTAIEIRNFLGEKKVRKVDLLEGVSVVRSEKVKDELVLDGNDIELVSRSCALINQKCHVKKKDIRKFLDGIYVSEKGTIAEE 439
            INASITNSN+AIEIRNFLGEKKVRKVD+LEGV+VVRSEKVKDELVLDGNDIELVSRS ALINQKCHVK KDIRKFLDGIYVSEKGT+AE+
Sbjct:  104 INASITNSNSAIEIRNFLGEKKVRKVDMLEGVTVVRSEKVKDELVLDGNDIELVSRSAALINQKCHVKNKDIRKFLDGIYVSEKGTVAEQ 193          
BLAST of GH720003 vs. TrEMBL
Match: A9PCN3_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_569228 PE=2 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 1.855e-39
Identity = 83/90 (92.22%), Postives = 86/90 (95.56%), Query Frame = -3
Query:  170 INASITNSNTAIEIRNFLGEKKVRKVDLLEGVSVVRSEKVKDELVLDGNDIELVSRSCALINQKCHVKKKDIRKFLDGIYVSEKGTIAEE 439
            INASITNSN AIEIRNFLGEKKVRKVD+LEGVS+VRSEKVKDELVLDGNDIELVSRS ALINQKCHVK KDIRKFLDGIYVSEKGT+ EE
Sbjct:  103 INASITNSNAAIEIRNFLGEKKVRKVDMLEGVSIVRSEKVKDELVLDGNDIELVSRSAALINQKCHVKNKDIRKFLDGIYVSEKGTVVEE 192          
BLAST of GH720003 vs. TrEMBL
Match: B9SBM0_RICCO (60S ribosomal protein L9, putative OS=Ricinus communis GN=RCOM_0342660 PE=4 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 2.422e-39
Identity = 84/90 (93.33%), Postives = 87/90 (96.67%), Query Frame = -3
Query:  170 INASITNSNTAIEIRNFLGEKKVRKVDLLEGVSVVRSEKVKDELVLDGNDIELVSRSCALINQKCHVKKKDIRKFLDGIYVSEKGTIAEE 439
            INASITNSNTAIEIRNFLGEKKVRKVD+LEGV+VVRSEKVKDELVLDG+DIELVSRS ALINQKCHVK KDIRKFLDGIYVSEKGTI EE
Sbjct:  104 INASITNSNTAIEIRNFLGEKKVRKVDMLEGVTVVRSEKVKDELVLDGSDIELVSRSAALINQKCHVKNKDIRKFLDGIYVSEKGTIVEE 193          
BLAST of GH720003 vs. TrEMBL
Match: A9P941_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_550502 PE=2 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 2.422e-39
Identity = 82/90 (91.11%), Postives = 87/90 (96.67%), Query Frame = -3
Query:  170 INASITNSNTAIEIRNFLGEKKVRKVDLLEGVSVVRSEKVKDELVLDGNDIELVSRSCALINQKCHVKKKDIRKFLDGIYVSEKGTIAEE 439
            INASITNSNTAIEIRNFLGEKKVRKVD+L+GVS++RSEKVKDELVLDGNDIELVSRS ALINQKCHVK KDIRKFLDGIYVSEKGT+ EE
Sbjct:  103 INASITNSNTAIEIRNFLGEKKVRKVDMLDGVSILRSEKVKDELVLDGNDIELVSRSAALINQKCHVKNKDIRKFLDGIYVSEKGTVVEE 192          
BLAST of GH720003 vs. TrEMBL
Match: C6T017_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 5.396e-39
Identity = 83/90 (92.22%), Postives = 85/90 (94.44%), Query Frame = -3
Query:  170 INASITNSNTAIEIRNFLGEKKVRKVDLLEGVSVVRSEKVKDELVLDGNDIELVSRSCALINQKCHVKKKDIRKFLDGIYVSEKGTIAEE 439
            INASI N N +IEIRNFLGEKKVRKVDLL GVSVVRSEKVKDEL+LDGNDIELVSRSCALINQKCHVKKKDIRKFLDGIYVSEKGTI EE
Sbjct:  103 INASIGNDNKSIEIRNFLGEKKVRKVDLLNGVSVVRSEKVKDELILDGNDIELVSRSCALINQKCHVKKKDIRKFLDGIYVSEKGTILEE 192          
BLAST of GH720003 vs. TrEMBL
Match: C6SXS7_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 7.048e-39
Identity = 82/90 (91.11%), Postives = 86/90 (95.56%), Query Frame = -3
Query:  170 INASITNSNTAIEIRNFLGEKKVRKVDLLEGVSVVRSEKVKDELVLDGNDIELVSRSCALINQKCHVKKKDIRKFLDGIYVSEKGTIAEE 439
            INASI NSN +IEIRNFLGEKKVRKVD+L+GVSVVRSEKVKDEL+LDGNDIELVSRSCALINQKCHVK KDIRKFLDGIYVSEKGTI EE
Sbjct:  103 INASIGNSNKSIEIRNFLGEKKVRKVDMLDGVSVVRSEKVKDELILDGNDIELVSRSCALINQKCHVKNKDIRKFLDGIYVSEKGTILEE 192          
BLAST of GH720003 vs. TrEMBL
Match: B9I0P1_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_727272 PE=4 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 7.048e-39
Identity = 82/90 (91.11%), Postives = 87/90 (96.67%), Query Frame = -3
Query:  170 INASITNSNTAIEIRNFLGEKKVRKVDLLEGVSVVRSEKVKDELVLDGNDIELVSRSCALINQKCHVKKKDIRKFLDGIYVSEKGTIAEE 439
            INASITNS+TAIEIRNFLGEKKVRKVD+L+GVS+VRSEKVKDELVLDGNDIELVSRS ALINQKCHVK KDIRKFLDGIYVSEKGT+ EE
Sbjct:  103 INASITNSSTAIEIRNFLGEKKVRKVDMLDGVSIVRSEKVKDELVLDGNDIELVSRSAALINQKCHVKNKDIRKFLDGIYVSEKGTVFEE 192          
BLAST of GH720003 vs. TrEMBL
Match: Q6ZFJ5_ORYSJ (Putative 60S ribosomal protein L9 OS=Oryza sativa subsp. japonica GN=OJ1435_F07.31 PE=4 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 9.205e-39
Identity = 81/90 (90.00%), Postives = 87/90 (96.67%), Query Frame = -3
Query:  170 INASITNSNTAIEIRNFLGEKKVRKVDLLEGVSVVRSEKVKDELVLDGNDIELVSRSCALINQKCHVKKKDIRKFLDGIYVSEKGTIAEE 439
            INASITNSNTAIEIRNFLGEKKVRKVD+LEGV+++RSEKVKDELVLDGNDIELVSRS ALINQKCHVK KDIRKFLDGIYVS+KGTI E+
Sbjct:   93 INASITNSNTAIEIRNFLGEKKVRKVDMLEGVTILRSEKVKDELVLDGNDIELVSRSAALINQKCHVKNKDIRKFLDGIYVSDKGTITED 182          
BLAST of GH720003 vs. TrEMBL
Match: Q0J0R8_ORYSJ (Os09g0485900 protein OS=Oryza sativa subsp. japonica GN=Os09g0485900 PE=4 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 9.205e-39
Identity = 81/90 (90.00%), Postives = 87/90 (96.67%), Query Frame = -3
Query:  170 INASITNSNTAIEIRNFLGEKKVRKVDLLEGVSVVRSEKVKDELVLDGNDIELVSRSCALINQKCHVKKKDIRKFLDGIYVSEKGTIAEE 439
            INASITNSNTAIEIRNFLGEKKVRKVD+LEGV+++RSEKVKDELVLDGNDIELVSRS ALINQKCHVK KDIRKFLDGIYVS+KGTI E+
Sbjct:  100 INASITNSNTAIEIRNFLGEKKVRKVDMLEGVTILRSEKVKDELVLDGNDIELVSRSAALINQKCHVKNKDIRKFLDGIYVSDKGTITED 189          
BLAST of GH720003 vs. TrEMBL
Match: Q0E4R7_ORYSJ (Os02g0103700 protein OS=Oryza sativa subsp. japonica GN=Os02g0103700 PE=2 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 9.205e-39
Identity = 81/90 (90.00%), Postives = 87/90 (96.67%), Query Frame = -3
Query:  170 INASITNSNTAIEIRNFLGEKKVRKVDLLEGVSVVRSEKVKDELVLDGNDIELVSRSCALINQKCHVKKKDIRKFLDGIYVSEKGTIAEE 439
            INASITNSNTAIEIRNFLGEKKVRKVD+LEGV+++RSEKVKDELVLDGNDIELVSRS ALINQKCHVK KDIRKFLDGIYVS+KGTI E+
Sbjct:  102 INASITNSNTAIEIRNFLGEKKVRKVDMLEGVTILRSEKVKDELVLDGNDIELVSRSAALINQKCHVKNKDIRKFLDGIYVSDKGTITED 191          
BLAST of GH720003 vs. SwissProt
Match: RL9_ORYSJ (60S ribosomal protein L9 OS=Oryza sativa subsp. japonica GN=RPL9 PE=2 SV=3)

HSP 1 Score: 162.925 bits (411), Expect = 5.752e-40
Identity = 81/90 (90.00%), Postives = 87/90 (96.67%), Query Frame = -3
Query:  170 INASITNSNTAIEIRNFLGEKKVRKVDLLEGVSVVRSEKVKDELVLDGNDIELVSRSCALINQKCHVKKKDIRKFLDGIYVSEKGTIAEE 439
            INASITNSNTAIEIRNFLGEKKVRKVD+LEGV+++RSEKVKDELVLDGNDIELVSRS ALINQKCHVK KDIRKFLDGIYVS+KGTI E+
Sbjct:  100 INASITNSNTAIEIRNFLGEKKVRKVDMLEGVTILRSEKVKDELVLDGNDIELVSRSAALINQKCHVKNKDIRKFLDGIYVSDKGTITED 189          
BLAST of GH720003 vs. SwissProt
Match: RL9_PEA (60S ribosomal protein L9 OS=Pisum sativum GN=RPL9 PE=2 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 2.186e-39
Identity = 79/90 (87.78%), Postives = 85/90 (94.44%), Query Frame = -3
Query:  170 INASITNSNTAIEIRNFLGEKKVRKVDLLEGVSVVRSEKVKDELVLDGNDIELVSRSCALINQKCHVKKKDIRKFLDGIYVSEKGTIAEE 439
            INASITN N +IEIRNFLGEKKVRKVDLL+GVS++RSEKVKDE+VLDGNDIELVSRSCALINQKCHVKKKDIRKFLDGIYVSEKG +  E
Sbjct:  103 INASITNDNKSIEIRNFLGEKKVRKVDLLDGVSIIRSEKVKDEVVLDGNDIELVSRSCALINQKCHVKKKDIRKFLDGIYVSEKGAVVVE 192          
BLAST of GH720003 vs. SwissProt
Match: RL92_ARATH (60S ribosomal protein L9-2 OS=Arabidopsis thaliana GN=RPL9D PE=2 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 4.557e-37
Identity = 75/90 (83.33%), Postives = 84/90 (93.33%), Query Frame = -3
Query:  170 INASITNSNTAIEIRNFLGEKKVRKVDLLEGVSVVRSEKVKDELVLDGNDIELVSRSCALINQKCHVKKKDIRKFLDGIYVSEKGTIAEE 439
            INASI  +N +IEIRNFLGEKKVRKV++L+GV +VRSEKVKDE++L+GNDIELVSRSCALINQKCHVKKKDIRKFLDGIYVSEKG IA E
Sbjct:  104 INASIDGNNKSIEIRNFLGEKKVRKVEMLDGVKIVRSEKVKDEIILEGNDIELVSRSCALINQKCHVKKKDIRKFLDGIYVSEKGKIAVE 193          
BLAST of GH720003 vs. SwissProt
Match: RL91_ARATH (60S ribosomal protein L9-1 OS=Arabidopsis thaliana GN=RPL9B PE=2 SV=3)

HSP 1 Score: 151.369 bits (381), Expect = 1.732e-36
Identity = 75/90 (83.33%), Postives = 82/90 (91.11%), Query Frame = -3
Query:  170 INASITNSNTAIEIRNFLGEKKVRKVDLLEGVSVVRSEKVKDELVLDGNDIELVSRSCALINQKCHVKKKDIRKFLDGIYVSEKGTIAEE 439
            INASI     +IEIRNFLGEKKVRKV++L+GV++VRSEKVKDE+VLDGNDIELVSRSCALINQKCHVKKKDIRKFLDGIYVSEK  I EE
Sbjct:  104 INASIGGDGKSIEIRNFLGEKKVRKVEMLDGVTIVRSEKVKDEIVLDGNDIELVSRSCALINQKCHVKKKDIRKFLDGIYVSEKSKIVEE 193          
BLAST of GH720003 vs. SwissProt
Match: RL9_ICTPU (60S ribosomal protein L9 OS=Ictalurus punctatus GN=rpl9 PE=2 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 2.196e-23
Identity = 56/89 (62.92%), Postives = 65/89 (73.03%), Query Frame = -3
Query:  173 INASITNSNTAIEIRNFLGEKKVRKVDLLEGVSVVRSEKVKDELVLDGNDIELVSRSCALINQKCHVKKKDIRKFLDGIYVSEKGTIAE 439
            IN  I  + + +EIRNFLGEK +R+V +  GV+   S   KDELVL+GNDIELVS S ALI Q   VK KDIRKFLDGIYVSEKGT+ E
Sbjct:  101 INVVIQETGSLVEIRNFLGEKYIRRVRMRPGVNCALSAAQKDELVLEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVVE 189          
BLAST of GH720003 vs. SwissProt
Match: RL9_DROME (60S ribosomal protein L9 OS=Drosophila melanogaster GN=RpL9 PE=1 SV=2)

HSP 1 Score: 107.842 bits (268), Expect = 2.196e-23
Identity = 54/89 (60.67%), Postives = 67/89 (75.28%), Query Frame = -3
Query:  173 INASITNSNTAIEIRNFLGEKKVRKVDLLEGVSVVRSEKVKDELVLDGNDIELVSRSCALINQKCHVKKKDIRKFLDGIYVSEKGTIAE 439
            IN   + +NT IEIRNFLGEK +R+V++  GV+VV S   KDEL+++GNDIE VS S ALI Q   VK KDIRKFLDG+YVSEK T+ +
Sbjct:   99 INCVTSENNTVIEIRNFLGEKYIRRVEMAPGVTVVNSTAQKDELIVEGNDIESVSGSAALIQQSTTVKNKDIRKFLDGLYVSEKTTVVK 187          
BLAST of GH720003 vs. SwissProt
Match: RL9_RAT (60S ribosomal protein L9 OS=Rattus norvegicus GN=Rpl9 PE=1 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 8.344e-23
Identity = 54/89 (60.67%), Postives = 66/89 (74.16%), Query Frame = -3
Query:  173 INASITNSNTAIEIRNFLGEKKVRKVDLLEGVSVVRSEKVKDELVLDGNDIELVSRSCALINQKCHVKKKDIRKFLDGIYVSEKGTIAE 439
            IN  I  + + +EIRNFLGEK +R+V +  GV+   S+  KDEL+L+GNDIELVS S ALI Q   VK KDIRKFLDGIYVSEKGT+ +
Sbjct:  101 INVVIQENGSLVEIRNFLGEKYIRRVRMRTGVACSVSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQ 189          
BLAST of GH720003 vs. SwissProt
Match: RL9_MOUSE (60S ribosomal protein L9 OS=Mus musculus GN=Rpl9 PE=2 SV=2)

HSP 1 Score: 105.916 bits (263), Expect = 8.344e-23
Identity = 54/89 (60.67%), Postives = 66/89 (74.16%), Query Frame = -3
Query:  173 INASITNSNTAIEIRNFLGEKKVRKVDLLEGVSVVRSEKVKDELVLDGNDIELVSRSCALINQKCHVKKKDIRKFLDGIYVSEKGTIAE 439
            IN  I  + + +EIRNFLGEK +R+V +  GV+   S+  KDEL+L+GNDIELVS S ALI Q   VK KDIRKFLDGIYVSEKGT+ +
Sbjct:  101 INVVIQENGSLVEIRNFLGEKYIRRVRMRTGVACSVSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQ 189          
BLAST of GH720003 vs. SwissProt
Match: RL9_MACFA (60S ribosomal protein L9 OS=Macaca fascicularis GN=RPL9 PE=2 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 8.344e-23
Identity = 54/89 (60.67%), Postives = 66/89 (74.16%), Query Frame = -3
Query:  173 INASITNSNTAIEIRNFLGEKKVRKVDLLEGVSVVRSEKVKDELVLDGNDIELVSRSCALINQKCHVKKKDIRKFLDGIYVSEKGTIAE 439
            IN  I  + + +EIRNFLGEK +R+V +  GV+   S+  KDEL+L+GNDIELVS S ALI Q   VK KDIRKFLDGIYVSEKGT+ +
Sbjct:  101 INVVIQENGSLVEIRNFLGEKYIRRVRMRPGVACSVSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQ 189          
BLAST of GH720003 vs. SwissProt
Match: RL9_HUMAN (60S ribosomal protein L9 OS=Homo sapiens GN=RPL9 PE=1 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 8.344e-23
Identity = 54/89 (60.67%), Postives = 66/89 (74.16%), Query Frame = -3
Query:  173 INASITNSNTAIEIRNFLGEKKVRKVDLLEGVSVVRSEKVKDELVLDGNDIELVSRSCALINQKCHVKKKDIRKFLDGIYVSEKGTIAE 439
            IN  I  + + +EIRNFLGEK +R+V +  GV+   S+  KDEL+L+GNDIELVS S ALI Q   VK KDIRKFLDGIYVSEKGT+ +
Sbjct:  101 INVVIQENGSLVEIRNFLGEKYIRRVRMRPGVACSVSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQ 189          
BLAST of GH720003 vs. TAIR peptide
Match: AT4G10450.1 (| Symbols: | Ribosomal protein L6 family | chr4:6463201-6464458 REVERSE LENGTH=194)

HSP 1 Score: 153.295 bits (386), Expect = 5.448e-38
Identity = 75/90 (83.33%), Postives = 84/90 (93.33%), Query Frame = -3
Query:  170 INASITNSNTAIEIRNFLGEKKVRKVDLLEGVSVVRSEKVKDELVLDGNDIELVSRSCALINQKCHVKKKDIRKFLDGIYVSEKGTIAEE 439
            INASI  +N +IEIRNFLGEKKVRKV++L+GV +VRSEKVKDE++L+GNDIELVSRSCALINQKCHVKKKDIRKFLDGIYVSEKG IA E
Sbjct:  104 INASIDGNNKSIEIRNFLGEKKVRKVEMLDGVKIVRSEKVKDEIILEGNDIELVSRSCALINQKCHVKKKDIRKFLDGIYVSEKGKIAVE 193          
BLAST of GH720003 vs. TAIR peptide
Match: AT1G33140.1 (| Symbols: PGY2 | Ribosomal protein L6 family | chr1:12023360-12024502 FORWARD LENGTH=194)

HSP 1 Score: 151.369 bits (381), Expect = 2.070e-37
Identity = 75/90 (83.33%), Postives = 82/90 (91.11%), Query Frame = -3
Query:  170 INASITNSNTAIEIRNFLGEKKVRKVDLLEGVSVVRSEKVKDELVLDGNDIELVSRSCALINQKCHVKKKDIRKFLDGIYVSEKGTIAEE 439
            INASI     +IEIRNFLGEKKVRKV++L+GV++VRSEKVKDE+VLDGNDIELVSRSCALINQKCHVKKKDIRKFLDGIYVSEK  I EE
Sbjct:  104 INASIGGDGKSIEIRNFLGEKKVRKVEMLDGVTIVRSEKVKDEIVLDGNDIELVSRSCALINQKCHVKKKDIRKFLDGIYVSEKSKIVEE 193          
BLAST of GH720003 vs. TAIR peptide
Match: AT1G33120.1 (| Symbols: | Ribosomal protein L6 family | chr1:12010986-12012223 FORWARD LENGTH=194)

HSP 1 Score: 151.369 bits (381), Expect = 2.070e-37
Identity = 75/90 (83.33%), Postives = 82/90 (91.11%), Query Frame = -3
Query:  170 INASITNSNTAIEIRNFLGEKKVRKVDLLEGVSVVRSEKVKDELVLDGNDIELVSRSCALINQKCHVKKKDIRKFLDGIYVSEKGTIAEE 439
            INASI     +IEIRNFLGEKKVRKV++L+GV++VRSEKVKDE+VLDGNDIELVSRSCALINQKCHVKKKDIRKFLDGIYVSEK  I EE
Sbjct:  104 INASIGGDGKSIEIRNFLGEKKVRKVEMLDGVTIVRSEKVKDEIVLDGNDIELVSRSCALINQKCHVKKKDIRKFLDGIYVSEKSKIVEE 193          
The following BLAST results are available for this feature:
BLAST of GH720003 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
B9RYZ1_RICCO1.855e-3992.2260S ribosomal protein L9, putative OS=Ricinus comm... [more]
A9PCN3_POPTR1.855e-3992.22Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
B9SBM0_RICCO2.422e-3993.3360S ribosomal protein L9, putative OS=Ricinus comm... [more]
A9P941_POPTR2.422e-3991.11Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
C6T017_SOYBN5.396e-3992.22Putative uncharacterized protein OS=Glycine max PE... [more]
C6SXS7_SOYBN7.048e-3991.11Putative uncharacterized protein OS=Glycine max PE... [more]
B9I0P1_POPTR7.048e-3991.11Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
Q6ZFJ5_ORYSJ9.205e-3990.00Putative 60S ribosomal protein L9 OS=Oryza sativa ... [more]
Q0J0R8_ORYSJ9.205e-3990.00Os09g0485900 protein OS=Oryza sativa subsp. japoni... [more]
Q0E4R7_ORYSJ9.205e-3990.00Os02g0103700 protein OS=Oryza sativa subsp. japoni... [more]
back to top
BLAST of GH720003 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Swissprot)
Total hits: 10
Match NameE-valueIdentityDescription
RL9_ORYSJ5.752e-4090.0060S ribosomal protein L9 OS=Oryza sativa subsp. ja... [more]
RL9_PEA2.186e-3987.7860S ribosomal protein L9 OS=Pisum sativum GN=RPL9 ... [more]
RL92_ARATH4.557e-3783.3360S ribosomal protein L9-2 OS=Arabidopsis thaliana... [more]
RL91_ARATH1.732e-3683.3360S ribosomal protein L9-1 OS=Arabidopsis thaliana... [more]
RL9_ICTPU2.196e-2362.9260S ribosomal protein L9 OS=Ictalurus punctatus GN... [more]
RL9_DROME2.196e-2360.6760S ribosomal protein L9 OS=Drosophila melanogaste... [more]
RL9_RAT8.344e-2360.6760S ribosomal protein L9 OS=Rattus norvegicus GN=R... [more]
RL9_MOUSE8.344e-2360.6760S ribosomal protein L9 OS=Mus musculus GN=Rpl9 P... [more]
RL9_MACFA8.344e-2360.6760S ribosomal protein L9 OS=Macaca fascicularis GN... [more]
RL9_HUMAN8.344e-2360.6760S ribosomal protein L9 OS=Homo sapiens GN=RPL9 P... [more]
back to top
BLAST of GH720003 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide)
Total hits: 3
Match NameE-valueIdentityDescription
AT4G10450.15.448e-3883.33| Symbols: | Ribosomal protein L6 family | chr4:6... [more]
AT1G33140.12.070e-3783.33| Symbols: PGY2 | Ribosomal protein L6 family | ch... [more]
AT1G33120.12.070e-3783.33| Symbols: | Ribosomal protein L6 family | chr1:1... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSEGsegsegcoord: 66..85
score
NoneNo IPR availablePANTHERPTHR11655:SF260S RIBOSOMAL PROTEIN L9coord: 7..96
score: 3.9
IPR000702Ribosomal protein L6PANTHERPTHR1165560S/50S RIBOSOMAL PROTEIN L6/L9coord: 7..96
score: 3.9
IPR002359Ribosomal protein L6, conserved site-2PROSITEPS00700RIBOSOMAL_L6_2coord: 69..90
score
IPR020040Ribosomal protein L6, alpha-beta domainGENE3D3.90.930.12no descriptioncoord: 7..95
score: 2.3
IPR020040Ribosomal protein L6, alpha-beta domainPFAMPF00347Ribosomal_L6coord: 10..84
score: 2.8
IPR020040Ribosomal protein L6, alpha-beta domainSUPERFAMILY56053Ribosomal protein L6coord: 7..91
score: 9.5

Properties
Property NameValue
Singlet in analysisPisum sativum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>GH720003 ID=GH720003|Name=GH720003|organism=Pisum sativum|type=EST|length=459bp
AAAAAAATTCAAATAACTTCCAAAAATATAACTTTGATAACACAAAATTG
TGAATTAATCAAAAAAAAGCTAATAAACACCATCACAGAGTATCATCACT
AAACAGTAACAATGCATGCAAATGAGAAAATCAAACTACCATCAATATTT
CCTAATTGCCCACCATCTATTCTTCAGCTATTGTCCCCTTCTCGCTAACA
TAGATACCATCAAGGAACTTCCGGATATCTTTCTTCTTAACATGGCATTT
CTGGTTAATAAGAGCACAAGATCTGGAAACAAGTTCAATGTCATTTCCAT
CCAAAACCAACTCATCCTTAACCTTTTCAGATCGAACAACACTAACTCCT
TCAAGGAGATCCACTTTCCTTACCTTCTTTTCGCCAAGGAAATTACGAAT
CTCGATAGCAGTATTACTGTTAGTGATACTAGCATTAATCACCTCGGCCG
CGACCACGC
back to top
Annotated Terms
The following terms have been associated with this EST:
Vocabulary: Molecular Function
TermDefinition
GO:0003735structural constituent of ribosome
GO:0019843rRNA binding
Vocabulary: Cellular Component
TermDefinition
GO:0005840ribosome
GO:0005622intracellular
Vocabulary: Biological Process
TermDefinition
GO:0006412translation
Vocabulary: INTERPRO
TermDefinition
IPR000702Ribosomal_L6
IPR002359Ribosomal_L6_CS2
IPR020040Ribosomal_L6_a/b-dom