GH720869

EST Overview
NameGH720869
Unique NameGH720869
TypeEST
OrganismPisum sativum (pea)
Sequence length520
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
Pisum sativum unigene v12010-12-27
Homology Analysis: Pisum sativum unigene v1 vs Trembl2010-12-28
InterProScan analysis for Pisum sativum unigene v12010-12-29
Libraries
Library NameType
LIBEST_024273 BACNIcdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Pisum sativum unigene v1Pisum sativum unigene v1EST
Homology
BLAST of GH720869 vs. TrEMBL
Match: C6T120_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 6.787e-30
Identity = 60/66 (90.91%), Postives = 63/66 (95.45%), Query Frame = -1
Query:  317 SRPRYSTFVNWEFWWPNFPILVYFKETQTKPEGQIHFFPIIFNGKQLYDVMVERAGSSKTSAPKES 514
            +R +YSTFVNWEFWWPNFPILVYFKE+QTKPEGQIHFFPIIFNGKQLYDVMVERAG SKTS PKES
Sbjct:  147 NRWKYSTFVNWEFWWPNFPILVYFKESQTKPEGQIHFFPIIFNGKQLYDVMVERAGPSKTSGPKES 212          
BLAST of GH720869 vs. TrEMBL
Match: B9SES2_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_0223700 PE=4 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 1.280e-28
Identity = 56/66 (84.85%), Postives = 62/66 (93.94%), Query Frame = -1
Query:  317 SRPRYSTFVNWEFWWPNFPILVYFKETQTKPEGQIHFFPIIFNGKQLYDVMVERAGSSKTSAPKES 514
            +R +YSTFVNWE WWPNFPILVYFKE+QTKPEGQ+HFFP+IFNGKQLYDVMVERAG SKTS PK+S
Sbjct:  144 NRWKYSTFVNWELWWPNFPILVYFKESQTKPEGQVHFFPVIFNGKQLYDVMVERAGPSKTSGPKQS 209          
BLAST of GH720869 vs. TrEMBL
Match: B9HAL0_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_560613 PE=4 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 2.183e-28
Identity = 56/64 (87.50%), Postives = 60/64 (93.75%), Query Frame = -1
Query:  323 SRPRYSTFVNWEFWWPNFPILVYFKETQTKPEGQIHFFPIIFNGKQLYDVMVERAGSSKTSAPK 514
            +R +YSTFVNWE WWPNFPILVYFKETQTKPEGQ+HFFP+IFNGKQLYDVMVERAG SKTS PK
Sbjct:  140 NRWKYSTFVNWELWWPNFPILVYFKETQTKPEGQVHFFPVIFNGKQLYDVMVERAGPSKTSGPK 203          
BLAST of GH720869 vs. TrEMBL
Match: D7TC09_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_16.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00015531001 PE=4 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 4.864e-28
Identity = 55/64 (85.94%), Postives = 60/64 (93.75%), Query Frame = -1
Query:  323 SRPRYSTFVNWEFWWPNFPILVYFKETQTKPEGQIHFFPIIFNGKQLYDVMVERAGSSKTSAPK 514
            +R +YSTFVNWE WWPNFPILVYFKETQT+PEGQ+HFFP+IFNGKQLYDVMVERAG SKTS PK
Sbjct:  145 NRWKYSTFVNWELWWPNFPILVYFKETQTRPEGQVHFFPVIFNGKQLYDVMVERAGPSKTSGPK 208          
BLAST of GH720869 vs. TrEMBL
Match: C5Y011_SORBI (Putative uncharacterized protein Sb04g010390 OS=Sorghum bicolor GN=Sb04g010390 PE=4 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.848e-27
Identity = 55/64 (85.94%), Postives = 59/64 (92.19%), Query Frame = -1
Query:  323 SRPRYSTFVNWEFWWPNFPILVYFKETQTKPEGQIHFFPIIFNGKQLYDVMVERAGSSKTSAPK 514
            +R +YSTFVNWE WWP FPILVYFKETQTKPEGQIHFFP+IFNG+QLYDVMVERAG SKTS PK
Sbjct:  149 NRWKYSTFVNWELWWPQFPILVYFKETQTKPEGQIHFFPVIFNGRQLYDVMVERAGPSKTSGPK 212          
BLAST of GH720869 vs. TrEMBL
Match: A9NLB2_PICSI (Putative uncharacterized protein OS=Picea sitchensis PE=2 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 4.117e-27
Identity = 53/61 (86.89%), Postives = 57/61 (93.44%), Query Frame = -1
Query:  323 RYSTFVNWEFWWPNFPILVYFKETQTKPEGQIHFFPIIFNGKQLYDVMVERAGSSKTSAPK 505
            ++STFVNWE WWPNFPILVYFKETQTKPEGQ+HFFP+IFNGKQLYDVMVERAG SK S PK
Sbjct:  160 KFSTFVNWELWWPNFPILVYFKETQTKPEGQVHFFPVIFNGKQLYDVMVERAGPSKNSGPK 220          
BLAST of GH720869 vs. TrEMBL
Match: Q0DIC2_ORYSJ (Os05g0401200 protein OS=Oryza sativa subsp. japonica GN=Os05g0401200 PE=4 SV=2)

HSP 1 Score: 123.635 bits (309), Expect = 7.023e-27
Identity = 54/64 (84.38%), Postives = 58/64 (90.62%), Query Frame = -1
Query:  323 SRPRYSTFVNWEFWWPNFPILVYFKETQTKPEGQIHFFPIIFNGKQLYDVMVERAGSSKTSAPK 514
            +R RYSTFVNWE WWP FPILVYFKETQTKPEGQIHFFP+IFNG+QLYD MVERAG S+TS PK
Sbjct:   33 NRWRYSTFVNWELWWPQFPILVYFKETQTKPEGQIHFFPVIFNGRQLYDAMVERAGPSETSGPK 96          
BLAST of GH720869 vs. TrEMBL
Match: B9FIC8_ORYSJ (Putative uncharacterized protein OS=Oryza sativa subsp. japonica GN=OsJ_18481 PE=4 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 7.023e-27
Identity = 54/64 (84.38%), Postives = 58/64 (90.62%), Query Frame = -1
Query:  323 SRPRYSTFVNWEFWWPNFPILVYFKETQTKPEGQIHFFPIIFNGKQLYDVMVERAGSSKTSAPK 514
            +R RYSTFVNWE WWP FPILVYFKETQTKPEGQIHFFP+IFNG+QLYD MVERAG S+TS PK
Sbjct:  124 NRWRYSTFVNWELWWPQFPILVYFKETQTKPEGQIHFFPVIFNGRQLYDAMVERAGPSETSGPK 187          
BLAST of GH720869 vs. TrEMBL
Match: A2Y4H0_ORYSI (Putative uncharacterized protein OS=Oryza sativa subsp. indica GN=OsI_19899 PE=4 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 7.023e-27
Identity = 54/64 (84.38%), Postives = 58/64 (90.62%), Query Frame = -1
Query:  323 SRPRYSTFVNWEFWWPNFPILVYFKETQTKPEGQIHFFPIIFNGKQLYDVMVERAGSSKTSAPK 514
            +R RYSTFVNWE WWP FPILVYFKETQTKPEGQIHFFP+IFNG+QLYD MVERAG S+TS PK
Sbjct:  124 NRWRYSTFVNWELWWPQFPILVYFKETQTKPEGQIHFFPVIFNGRQLYDAMVERAGPSETSGPK 187          
BLAST of GH720869 vs. TrEMBL
Match: C0P2C7_MAIZE (Putative uncharacterized protein OS=Zea mays PE=2 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 9.173e-27
Identity = 53/64 (82.81%), Postives = 59/64 (92.19%), Query Frame = -1
Query:  323 SRPRYSTFVNWEFWWPNFPILVYFKETQTKPEGQIHFFPIIFNGKQLYDVMVERAGSSKTSAPK 514
            +R +YSTFVNWE WWP FP+LVYFKETQTKPEGQIHFFP+IF+G+QLYDVMVERAG SKTS PK
Sbjct:  114 NRWKYSTFVNWELWWPQFPVLVYFKETQTKPEGQIHFFPVIFDGRQLYDVMVERAGPSKTSGPK 177          
The following BLAST results are available for this feature:
BLAST of GH720869 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
C6T120_SOYBN6.787e-3090.91Putative uncharacterized protein OS=Glycine max PE... [more]
B9SES2_RICCO1.280e-2884.85Putative uncharacterized protein OS=Ricinus commun... [more]
B9HAL0_POPTR2.183e-2887.50Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
D7TC09_VITVI4.864e-2885.94Whole genome shotgun sequence of line PN40024, sca... [more]
C5Y011_SORBI1.848e-2785.94Putative uncharacterized protein Sb04g010390 OS=So... [more]
A9NLB2_PICSI4.117e-2786.89Putative uncharacterized protein OS=Picea sitchens... [more]
Q0DIC2_ORYSJ7.023e-2784.38Os05g0401200 protein OS=Oryza sativa subsp. japoni... [more]
B9FIC8_ORYSJ7.023e-2784.38Putative uncharacterized protein OS=Oryza sativa s... [more]
A2Y4H0_ORYSI7.023e-2784.38Putative uncharacterized protein OS=Oryza sativa s... [more]
C0P2C7_MAIZE9.173e-2782.81Putative uncharacterized protein OS=Zea mays PE=2 ... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSEGsegsegcoord: 10..23
score
IPR021467Protein of unknown function DUF3119PFAMPF11317DUF3119coord: 6..58
score: 1.3

Properties
Property NameValue
Singlet in analysisPisum sativum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>GH720869 ID=GH720869|Name=GH720869|organism=Pisum sativum|type=EST|length=520bp
TTCGAGCGGCCGCCCGGGCAGGTACTGTGAAATTATAAAGTAAATAACTA
GCCAGTTCAAATAAATAGAATGTGCTACTTATGTGCTAGCAATACTAAAT
AATAATAAATGAATTGTTATTGTGCTTCAACTTGTATGCAACTTGAAACA
TCTGAGAGCACTGCATCATCTTCCACTAGCCACAAGCAACAACCCAAACT
TGAGAAACCTCCTTGCAGGATTCCCAAGATATCCTTGGTTTCAAAACTGT
AATTCGAAACAATTACTCCCTAGAGACATCGATTCCTGAGGCTCAAGCCA
CACAACTAAGTCTTTAGGATTCTTTTGGAGCACTAGTTTTTGAAGAACCA
GCTCTTTCCACCATAACATCATAAAGCTGCTTTCCATTAAAGATTATTGG
AAAGAAGTGAATTTGTCCTTCAGGCTTTGTTTGTGTTTCCTTGAAGTAAA
CCAAGATAGGGAAGTTTGGCCACCAGAATTCCCAATTCACGAAGGTTGAG
TACCTCGGCCGCGACCACGC
back to top
Annotated Terms
The following terms have been associated with this EST:
Vocabulary: INTERPRO
TermDefinition
IPR021467DUF3119