AJ308132

EST Overview
NameAJ308132
Unique NameAJ308132
TypeEST
OrganismPisum sativum (pea)
Sequence length407
Libraries
Library NameType
LIBEST_009888 SSHcdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Pisum sativum unigene v2Pisum sativum unigene v2EST
Pisum sativum unigene v1Pisum sativum unigene v1EST
Homology
BLAST of AJ308132 vs. TrEMBL
Match: Q43565_NARPS (Elongation factor (Fragment) OS=Narcissus pseudonarcissus PE=2 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.075e-18
Identity = 50/67 (74.63%), Postives = 53/67 (79.10%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKMIPT   V E  AEYPP+GRFAVRDMRQTVAVG IKSVEKKDPTG
Sbjct:  165 RSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPMGRFAVRDMRQTVAVGVIKSVEKKDPTG 231          
BLAST of AJ308132 vs. TrEMBL
Match: Q9SPA1_LILLO (Elongation factor 1-alpha OS=Lilium longiflorum PE=2 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 1.404e-18
Identity = 50/67 (74.63%), Postives = 53/67 (79.10%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKMIPT   V E  AEYPPLGRFAVRDMRQTVAVG IK+VEKKDPTG
Sbjct:  370 RSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 436          
BLAST of AJ308132 vs. TrEMBL
Match: Q9FYV3_SACOF (Elongation factor 1-alpha OS=Saccharum officinarum PE=2 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 1.404e-18
Identity = 50/67 (74.63%), Postives = 53/67 (79.10%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKMIPT   V E  +EYPPLGRFAVRDMRQTVAVG IKSVEKKDPTG
Sbjct:  371 RSGKELEKEAKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGIIKSVEKKDPTG 437          
BLAST of AJ308132 vs. TrEMBL
Match: Q58I24_ACTDE (Elongation factor 1-alpha OS=Actinidia deliciosa PE=2 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 1.404e-18
Identity = 50/67 (74.63%), Postives = 53/67 (79.10%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKMIPT   V E  +EYPPLGRFAVRDMRQTVAVG IKSVEKKDPTG
Sbjct:  370 RSGKELEKEPKFLKNGDSGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG 436          
BLAST of AJ308132 vs. TrEMBL
Match: Q3LUM1_GOSHI (Elongation factor 1-alpha OS=Gossypium hirsutum GN=EF1A6 PE=2 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 1.404e-18
Identity = 50/67 (74.63%), Postives = 53/67 (79.10%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKMIPT   V E  +EYPPLGRFAVRDMRQTVAVG IKSVEKKDPTG
Sbjct:  370 RSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG 436          
BLAST of AJ308132 vs. TrEMBL
Match: A8CYN3_GERHY (Elongation factor 1-alpha OS=Gerbera hybrida PE=2 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 1.404e-18
Identity = 50/67 (74.63%), Postives = 53/67 (79.10%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKMIPT   V E  AEYPPLGRFAVRDMRQTVAVG IKSV+KKDPTG
Sbjct:  370 RSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG 436          
BLAST of AJ308132 vs. TrEMBL
Match: Q8SAT2_SACOF (Elongation factor 1-alpha OS=Saccharum officinarum GN=SEF1a PE=3 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 1.833e-18
Identity = 49/67 (73.13%), Postives = 53/67 (79.10%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKM+PT   V E  +EYPPLGRFAVRDMRQTVAVG IKSVEKKDPTG
Sbjct:  370 RSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG 436          
BLAST of AJ308132 vs. TrEMBL
Match: Q8SAT1_SACOF (Elongation factor 1-alpha (Fragment) OS=Saccharum officinarum GN=SEF1a PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 1.833e-18
Identity = 49/67 (73.13%), Postives = 53/67 (79.10%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKM+PT   V E  +EYPPLGRFAVRDMRQTVAVG IKSVEKKDPTG
Sbjct:  364 RSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG 430          
BLAST of AJ308132 vs. TrEMBL
Match: Q3LUM5_GOSHI (Elongation factor 1-alpha OS=Gossypium hirsutum GN=EF1A2 PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 1.833e-18
Identity = 49/67 (73.13%), Postives = 53/67 (79.10%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GM+KMIPT   V E  +EYPPLGRFAVRDMRQTVAVG IKSVEKKDPTG
Sbjct:  370 RSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG 436          
BLAST of AJ308132 vs. TrEMBL
Match: B6UHJ4_MAIZE (Elongation factor 1-alpha OS=Zea mays PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 1.833e-18
Identity = 49/67 (73.13%), Postives = 53/67 (79.10%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKM+PT   V E  +EYPPLGRFAVRDMRQTVAVG IKSVEKKDPTG
Sbjct:  370 RSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG 436          
BLAST of AJ308132 vs. SwissProt
Match: EF1A_VICFA (Elongation factor 1-alpha OS=Vicia faba PE=2 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 3.100e-20
Identity = 51/67 (76.12%), Postives = 53/67 (79.10%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKMIPT   V E  AEYPPLGRFAVRDMRQTVAVG IKSVEKKDPTG
Sbjct:  370 RSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG 436          
BLAST of AJ308132 vs. SwissProt
Match: EF1A_PEA (Elongation factor 1-alpha OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 3.100e-20
Identity = 51/67 (76.12%), Postives = 53/67 (79.10%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKMIPT   V E  AEYPPLGRFAVRDMRQTVAVG IKSVEKKDPTG
Sbjct:  370 RSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG 436          
BLAST of AJ308132 vs. SwissProt
Match: EF1A_ORYSJ (Elongation factor 1-alpha OS=Oryza sativa subsp. japonica GN=REFA1 PE=2 SV=2)

HSP 1 Score: 94.7449 bits (234), Expect = 1.539e-19
Identity = 49/67 (73.13%), Postives = 53/67 (79.10%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKMIPT   V E  +EYPPLGRFAVRDMRQTVAVG IK+VEKKDPTG
Sbjct:  370 RSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 436          
BLAST of AJ308132 vs. SwissProt
Match: EF1A_SOLLC (Elongation factor 1-alpha OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 2.010e-19
Identity = 48/67 (71.64%), Postives = 53/67 (79.10%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKMIPT   V E  AEYPPLGRFAVRDMRQTVAVG +K+V+KKDPTG
Sbjct:  370 RSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG 436          
BLAST of AJ308132 vs. SwissProt
Match: EF1A_MAIZE (Elongation factor 1-alpha OS=Zea mays GN=EF1A PE=3 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 2.010e-19
Identity = 48/67 (71.64%), Postives = 53/67 (79.10%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKM+PT   V E  ++YPPLGRFAVRDMRQTVAVG IKSVEKKDPTG
Sbjct:  370 RSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG 436          
BLAST of AJ308132 vs. SwissProt
Match: EF1A_TOBAC (Elongation factor 1-alpha OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 3.428e-19
Identity = 48/67 (71.64%), Postives = 53/67 (79.10%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKMIPT   V E  +EYPPLGRFAVRDMRQTVAVG IK+V+KKDPTG
Sbjct:  370 RSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG 436          
BLAST of AJ308132 vs. SwissProt
Match: EF1A_SOYBN (Elongation factor 1-alpha OS=Glycine max GN=TEFS1 PE=3 SV=2)

HSP 1 Score: 92.8189 bits (229), Expect = 5.847e-19
Identity = 48/67 (71.64%), Postives = 52/67 (77.61%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  G VKMIPT   V E  +EYPPLGRFAVRDMRQTVAVG IK+VEKKDPTG
Sbjct:  370 RSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 436          
BLAST of AJ308132 vs. SwissProt
Match: EF1A_ARATH (Elongation factor 1-alpha OS=Arabidopsis thaliana GN=A1 PE=1 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 5.847e-19
Identity = 48/67 (71.64%), Postives = 52/67 (77.61%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKM PT   V E  +EYPPLGRFAVRDMRQTVAVG IKSV+KKDPTG
Sbjct:  370 RSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG 436          
BLAST of AJ308132 vs. SwissProt
Match: EF1A2_HORVU (Elongation factor 1-alpha OS=Hordeum vulgare GN=BLT63 PE=1 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 7.636e-19
Identity = 48/67 (71.64%), Postives = 52/67 (77.61%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  G VKMIPT   V E  A+YPPLGRFAVRDMRQTVAVG IKSVEKK+PTG
Sbjct:  370 RSGKELEAAPKFLKNGDAGFVKMIPTKPMVVETFAQYPPLGRFAVRDMRQTVAVGVIKSVEKKEPTG 436          
BLAST of AJ308132 vs. SwissProt
Match: EF1A1_HORVU (Elongation factor 1-alpha OS=Hordeum vulgare PE=1 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 7.636e-19
Identity = 48/67 (71.64%), Postives = 52/67 (77.61%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  G VKMIPT   V E  A+YPPLGRFAVRDMRQTVAVG IKSVEKK+PTG
Sbjct:  370 RSGKELEAAPKFLKNGDAGFVKMIPTKPMVVETFAQYPPLGRFAVRDMRQTVAVGVIKSVEKKEPTG 436          
BLAST of AJ308132 vs. TAIR peptide
Match: AT5G60390.3 (| Symbols: | GTP binding Elongation factor Tu family protein | chr5:24289226-24290675 FORWARD LENGTH=449)

HSP 1 Score: 92.8189 bits (229), Expect = 6.631e-20
Identity = 48/67 (71.64%), Postives = 52/67 (77.61%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKM PT   V E  +EYPPLGRFAVRDMRQTVAVG IKSV+KKDPTG
Sbjct:  370 RSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG 436          
BLAST of AJ308132 vs. TAIR peptide
Match: AT5G60390.1 (| Symbols: | GTP binding Elongation factor Tu family protein | chr5:24289226-24290675 FORWARD LENGTH=449)

HSP 1 Score: 92.8189 bits (229), Expect = 6.631e-20
Identity = 48/67 (71.64%), Postives = 52/67 (77.61%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKM PT   V E  +EYPPLGRFAVRDMRQTVAVG IKSV+KKDPTG
Sbjct:  370 RSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG 436          
BLAST of AJ308132 vs. TAIR peptide
Match: AT1G07930.2 (| Symbols: | GTP binding Elongation factor Tu family protein | chr1:2459014-2460458 FORWARD LENGTH=372)

HSP 1 Score: 92.8189 bits (229), Expect = 6.631e-20
Identity = 48/67 (71.64%), Postives = 52/67 (77.61%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKM PT   V E  +EYPPLGRFAVRDMRQTVAVG IKSV+KKDPTG
Sbjct:  293 RSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG 359          
BLAST of AJ308132 vs. TAIR peptide
Match: AT1G07940.2 (| Symbols: | GTP binding Elongation factor Tu family protein | chr1:2463350-2464792 REVERSE LENGTH=449)

HSP 1 Score: 92.8189 bits (229), Expect = 6.631e-20
Identity = 48/67 (71.64%), Postives = 52/67 (77.61%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKM PT   V E  +EYPPLGRFAVRDMRQTVAVG IKSV+KKDPTG
Sbjct:  370 RSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG 436          
BLAST of AJ308132 vs. TAIR peptide
Match: AT1G07940.1 (| Symbols: | GTP binding Elongation factor Tu family protein | chr1:2463350-2464792 REVERSE LENGTH=449)

HSP 1 Score: 92.8189 bits (229), Expect = 6.631e-20
Identity = 48/67 (71.64%), Postives = 52/67 (77.61%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKM PT   V E  +EYPPLGRFAVRDMRQTVAVG IKSV+KKDPTG
Sbjct:  370 RSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG 436          
BLAST of AJ308132 vs. TAIR peptide
Match: AT1G07930.1 (| Symbols: | GTP binding Elongation factor Tu family protein | chr1:2459014-2460458 FORWARD LENGTH=449)

HSP 1 Score: 92.8189 bits (229), Expect = 6.631e-20
Identity = 48/67 (71.64%), Postives = 52/67 (77.61%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKM PT   V E  +EYPPLGRFAVRDMRQTVAVG IKSV+KKDPTG
Sbjct:  370 RSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG 436          
BLAST of AJ308132 vs. TAIR peptide
Match: AT1G07920.1 (| Symbols: | GTP binding Elongation factor Tu family protein | chr1:2455559-2457001 FORWARD LENGTH=449)

HSP 1 Score: 92.8189 bits (229), Expect = 6.631e-20
Identity = 48/67 (71.64%), Postives = 52/67 (77.61%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKM PT   V E  +EYPPLGRFAVRDMRQTVAVG IKSV+KKDPTG
Sbjct:  370 RSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG 436          
BLAST of AJ308132 vs. TAIR peptide
Match: AT1G35550.1 (| Symbols: | elongation factor Tu C-terminal domain-containing protein | chr1:13112722-13113036 FORWARD LENGTH=104)

HSP 1 Score: 75.8702 bits (185), Expect = 8.389e-15
Identity = 36/57 (63.16%), Postives = 41/57 (71.93%), Query Frame = 1
Query:   49 KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            KFLKN    ++ M PT   V E  + YPPLGRFA+RDMRQTV VG IKSV KKDP+G
Sbjct:   46 KFLKNSEAAIINMTPTKPMVVEAYSAYPPLGRFAIRDMRQTVGVGVIKSVVKKDPSG 102          
BLAST of AJ308132 vs. TAIR peptide
Match: AT5G60390.3 (| Symbols: | GTP binding Elongation factor Tu family protein | chr5:24289226-24290675 FORWARD LENGTH=449)

HSP 1 Score: 92.8189 bits (229), Expect = 6.631e-20
Identity = 48/67 (71.64%), Postives = 52/67 (77.61%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKM PT   V E  +EYPPLGRFAVRDMRQTVAVG IKSV+KKDPTG
Sbjct:  370 RSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG 436          
BLAST of AJ308132 vs. TAIR peptide
Match: AT5G60390.1 (| Symbols: | GTP binding Elongation factor Tu family protein | chr5:24289226-24290675 FORWARD LENGTH=449)

HSP 1 Score: 92.8189 bits (229), Expect = 6.631e-20
Identity = 48/67 (71.64%), Postives = 52/67 (77.61%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKM PT   V E  +EYPPLGRFAVRDMRQTVAVG IKSV+KKDPTG
Sbjct:  370 RSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG 436          
BLAST of AJ308132 vs. TAIR peptide
Match: AT1G07930.2 (| Symbols: | GTP binding Elongation factor Tu family protein | chr1:2459014-2460458 FORWARD LENGTH=372)

HSP 1 Score: 92.8189 bits (229), Expect = 6.631e-20
Identity = 48/67 (71.64%), Postives = 52/67 (77.61%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKM PT   V E  +EYPPLGRFAVRDMRQTVAVG IKSV+KKDPTG
Sbjct:  293 RSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG 359          
BLAST of AJ308132 vs. TAIR peptide
Match: AT1G07940.2 (| Symbols: | GTP binding Elongation factor Tu family protein | chr1:2463350-2464792 REVERSE LENGTH=449)

HSP 1 Score: 92.8189 bits (229), Expect = 6.631e-20
Identity = 48/67 (71.64%), Postives = 52/67 (77.61%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKM PT   V E  +EYPPLGRFAVRDMRQTVAVG IKSV+KKDPTG
Sbjct:  370 RSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG 436          
BLAST of AJ308132 vs. TAIR peptide
Match: AT1G07940.1 (| Symbols: | GTP binding Elongation factor Tu family protein | chr1:2463350-2464792 REVERSE LENGTH=449)

HSP 1 Score: 92.8189 bits (229), Expect = 6.631e-20
Identity = 48/67 (71.64%), Postives = 52/67 (77.61%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKM PT   V E  +EYPPLGRFAVRDMRQTVAVG IKSV+KKDPTG
Sbjct:  370 RSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG 436          
BLAST of AJ308132 vs. TAIR peptide
Match: AT1G07930.1 (| Symbols: | GTP binding Elongation factor Tu family protein | chr1:2459014-2460458 FORWARD LENGTH=449)

HSP 1 Score: 92.8189 bits (229), Expect = 6.631e-20
Identity = 48/67 (71.64%), Postives = 52/67 (77.61%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKM PT   V E  +EYPPLGRFAVRDMRQTVAVG IKSV+KKDPTG
Sbjct:  370 RSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG 436          
BLAST of AJ308132 vs. TAIR peptide
Match: AT1G07920.1 (| Symbols: | GTP binding Elongation factor Tu family protein | chr1:2455559-2457001 FORWARD LENGTH=449)

HSP 1 Score: 92.8189 bits (229), Expect = 6.631e-20
Identity = 48/67 (71.64%), Postives = 52/67 (77.61%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKM PT   V E  +EYPPLGRFAVRDMRQTVAVG IKSV+KKDPTG
Sbjct:  370 RSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG 436          
BLAST of AJ308132 vs. TAIR peptide
Match: AT1G35550.1 (| Symbols: | elongation factor Tu C-terminal domain-containing protein | chr1:13112722-13113036 FORWARD LENGTH=104)

HSP 1 Score: 75.8702 bits (185), Expect = 8.389e-15
Identity = 36/57 (63.16%), Postives = 41/57 (71.93%), Query Frame = 1
Query:   49 KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            KFLKN    ++ M PT   V E  + YPPLGRFA+RDMRQTV VG IKSV KKDP+G
Sbjct:   46 KFLKNSEAAIINMTPTKPMVVEAYSAYPPLGRFAIRDMRQTVGVGVIKSVVKKDPSG 102          
BLAST of AJ308132 vs. TrEMBL
Match: Q43565_NARPS (Elongation factor (Fragment) OS=Narcissus pseudonarcissus PE=2 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.344e-18
Identity = 50/67 (74.63%), Postives = 53/67 (79.10%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKMIPT   V E  AEYPP+GRFAVRDMRQTVAVG IKSVEKKDPTG
Sbjct:  165 RSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPMGRFAVRDMRQTVAVGVIKSVEKKDPTG 231          
BLAST of AJ308132 vs. TrEMBL
Match: Q9SPA1_LILLO (Elongation factor 1-alpha OS=Lilium longiflorum PE=2 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 1.755e-18
Identity = 50/67 (74.63%), Postives = 53/67 (79.10%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKMIPT   V E  AEYPPLGRFAVRDMRQTVAVG IK+VEKKDPTG
Sbjct:  370 RSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 436          
BLAST of AJ308132 vs. TrEMBL
Match: Q9FYV3_SACOF (Elongation factor 1-alpha OS=Saccharum officinarum PE=2 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 1.755e-18
Identity = 50/67 (74.63%), Postives = 53/67 (79.10%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKMIPT   V E  +EYPPLGRFAVRDMRQTVAVG IKSVEKKDPTG
Sbjct:  371 RSGKELEKEAKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGIIKSVEKKDPTG 437          
BLAST of AJ308132 vs. TrEMBL
Match: Q58I24_ACTDE (Elongation factor 1-alpha OS=Actinidia deliciosa PE=2 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 1.755e-18
Identity = 50/67 (74.63%), Postives = 53/67 (79.10%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKMIPT   V E  +EYPPLGRFAVRDMRQTVAVG IKSVEKKDPTG
Sbjct:  370 RSGKELEKEPKFLKNGDSGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG 436          
BLAST of AJ308132 vs. TrEMBL
Match: Q3LUM1_GOSHI (Elongation factor 1-alpha OS=Gossypium hirsutum GN=EF1A6 PE=2 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 1.755e-18
Identity = 50/67 (74.63%), Postives = 53/67 (79.10%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKMIPT   V E  +EYPPLGRFAVRDMRQTVAVG IKSVEKKDPTG
Sbjct:  370 RSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG 436          
BLAST of AJ308132 vs. TrEMBL
Match: A8CYN3_GERHY (Elongation factor 1-alpha OS=Gerbera hybrida PE=2 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 1.755e-18
Identity = 50/67 (74.63%), Postives = 53/67 (79.10%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKMIPT   V E  AEYPPLGRFAVRDMRQTVAVG IKSV+KKDPTG
Sbjct:  370 RSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG 436          
BLAST of AJ308132 vs. TrEMBL
Match: Q8SAT2_SACOF (Elongation factor 1-alpha OS=Saccharum officinarum GN=SEF1a PE=3 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 2.292e-18
Identity = 49/67 (73.13%), Postives = 53/67 (79.10%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKM+PT   V E  +EYPPLGRFAVRDMRQTVAVG IKSVEKKDPTG
Sbjct:  370 RSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG 436          
BLAST of AJ308132 vs. TrEMBL
Match: Q8SAT1_SACOF (Elongation factor 1-alpha (Fragment) OS=Saccharum officinarum GN=SEF1a PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 2.292e-18
Identity = 49/67 (73.13%), Postives = 53/67 (79.10%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKM+PT   V E  +EYPPLGRFAVRDMRQTVAVG IKSVEKKDPTG
Sbjct:  364 RSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG 430          
BLAST of AJ308132 vs. TrEMBL
Match: Q3LUM5_GOSHI (Elongation factor 1-alpha OS=Gossypium hirsutum GN=EF1A2 PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 2.292e-18
Identity = 49/67 (73.13%), Postives = 53/67 (79.10%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GM+KMIPT   V E  +EYPPLGRFAVRDMRQTVAVG IKSVEKKDPTG
Sbjct:  370 RSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG 436          
BLAST of AJ308132 vs. TrEMBL
Match: B6UHJ4_MAIZE (Elongation factor 1-alpha OS=Zea mays PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 2.292e-18
Identity = 49/67 (73.13%), Postives = 53/67 (79.10%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKM+PT   V E  +EYPPLGRFAVRDMRQTVAVG IKSVEKKDPTG
Sbjct:  370 RSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG 436          
BLAST of AJ308132 vs. Lotus protein
Match: chr1.CM0001.850.r2.m (+ phase: 0 )

HSP 1 Score: 95.5153 bits (236), Expect = 6.266e-21
Identity = 49/67 (73.13%), Postives = 53/67 (79.10%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKM+PT   V E  +EYPPLGRFAVRDMRQTVAVG IKSVEKKDPTG
Sbjct:  370 RSGKEIEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG 436          
BLAST of AJ308132 vs. Lotus protein
Match: chr5.CM0909.990.r2.m (- phase: 0 )

HSP 1 Score: 94.7449 bits (234), Expect = 1.069e-20
Identity = 49/67 (73.13%), Postives = 53/67 (79.10%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  G+VKMIPT   V E  +EYPPLGRFAVRDMRQTVAVG IKSVEKKDPTG
Sbjct:  370 RSGKELEKDPKFLKNGDSGLVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG 436          
BLAST of AJ308132 vs. Lotus protein
Match: chr2.LjT12G08.20.r2.m (- phase: 0 )

HSP 1 Score: 92.4337 bits (228), Expect = 5.305e-20
Identity = 48/67 (71.64%), Postives = 52/67 (77.61%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  G VKMIPT   V E  +EYPPLGRFAVRDMRQTVAVG IKSVEKKDP+G
Sbjct:  370 RSGKEIEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG 436          
BLAST of AJ308132 vs. Lotus protein
Match: chr1.CM0192.300.r2.m (- phase: 0 /est)

HSP 1 Score: 71.2478 bits (173), Expect = 1.266e-13
Identity = 35/49 (71.43%), Postives = 38/49 (77.55%), Query Frame = 1
Query:   73 GMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            G VKMIPT   V E  +EYP LGRFAVRDMRQTV  G IKSVEKK+P+G
Sbjct:    1 GFVKMIPTKPMVVETFSEYPLLGRFAVRDMRQTVVTGVIKSVEKKEPSG 49          
BLAST of AJ308132 vs. Soybean peptides
Match: Glyma19g07240.2|PACid:16312145 ()

HSP 1 Score: 95.9005 bits (237), Expect = 1.136e-20
Identity = 50/67 (74.63%), Postives = 53/67 (79.10%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKMIPT   V E  +EYPPLGRFAVRDMRQTVAVG IKSVEKKDPTG
Sbjct:  370 RSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG 436          
BLAST of AJ308132 vs. Soybean peptides
Match: Glyma19g07240.1|PACid:16312144 ()

HSP 1 Score: 95.9005 bits (237), Expect = 1.136e-20
Identity = 50/67 (74.63%), Postives = 53/67 (79.10%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKMIPT   V E  +EYPPLGRFAVRDMRQTVAVG IKSVEKKDPTG
Sbjct:  370 RSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG 436          
BLAST of AJ308132 vs. Soybean peptides
Match: Glyma05g24110.1|PACid:16259441 ()

HSP 1 Score: 95.5153 bits (236), Expect = 1.483e-20
Identity = 49/67 (73.13%), Postives = 53/67 (79.10%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKM+PT   V E  +EYPPLGRFAVRDMRQTVAVG IKSVEKKDPTG
Sbjct:  370 RSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG 436          
BLAST of AJ308132 vs. Soybean peptides
Match: Glyma10g35700.1|PACid:16281083 ()

HSP 1 Score: 94.7449 bits (234), Expect = 2.530e-20
Identity = 49/67 (73.13%), Postives = 53/67 (79.10%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  G+VKMIPT   V E  +EYPPLGRFAVRDMRQTVAVG IKSVEKKDPTG
Sbjct:  370 RSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG 436          
BLAST of AJ308132 vs. Soybean peptides
Match: Glyma16g07350.1|PACid:16301782 ()

HSP 1 Score: 93.5893 bits (231), Expect = 5.636e-20
Identity = 49/67 (73.13%), Postives = 52/67 (77.61%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  G VKMIPT   V E  +EYPPLGRFAVRDMRQTVAVG IKSVEKKDPTG
Sbjct:  370 RSGKEIEKEPKFLKNGDAGYVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG 436          
BLAST of AJ308132 vs. Soybean peptides
Match: Glyma17g23900.1|PACid:16306364 ()

HSP 1 Score: 92.8189 bits (229), Expect = 9.614e-20
Identity = 48/67 (71.64%), Postives = 52/67 (77.61%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  G VKMIPT   V E  +EYPPLGRFAVRDMRQTVAVG IK+VEKKDPTG
Sbjct:  370 RSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 436          
BLAST of AJ308132 vs. Soybean peptides
Match: Glyma05g11630.1|PACid:16258859 ()

HSP 1 Score: 92.8189 bits (229), Expect = 9.614e-20
Identity = 48/67 (71.64%), Postives = 52/67 (77.61%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  G VKMIPT   V E  +EYPPLGRFAVRDMRQTVAVG IK+VEKKDPTG
Sbjct:  370 RSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 436          
BLAST of AJ308132 vs. SwissProt
Match: EF1A_VICFA (Elongation factor 1-alpha OS=Vicia faba PE=2 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 3.156e-20
Identity = 51/67 (76.12%), Postives = 53/67 (79.10%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKMIPT   V E  AEYPPLGRFAVRDMRQTVAVG IKSVEKKDPTG
Sbjct:  370 RSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG 436          
BLAST of AJ308132 vs. SwissProt
Match: EF1A_PEA (Elongation factor 1-alpha OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 3.156e-20
Identity = 51/67 (76.12%), Postives = 53/67 (79.10%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKMIPT   V E  AEYPPLGRFAVRDMRQTVAVG IKSVEKKDPTG
Sbjct:  370 RSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG 436          
BLAST of AJ308132 vs. SwissProt
Match: EF1A_ORYSJ (Elongation factor 1-alpha OS=Oryza sativa subsp. japonica GN=REFA1 PE=2 SV=2)

HSP 1 Score: 94.7449 bits (234), Expect = 1.566e-19
Identity = 49/67 (73.13%), Postives = 53/67 (79.10%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKMIPT   V E  +EYPPLGRFAVRDMRQTVAVG IK+VEKKDPTG
Sbjct:  370 RSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 436          
BLAST of AJ308132 vs. SwissProt
Match: EF1A_SOLLC (Elongation factor 1-alpha OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 2.046e-19
Identity = 48/67 (71.64%), Postives = 53/67 (79.10%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKMIPT   V E  AEYPPLGRFAVRDMRQTVAVG +K+V+KKDPTG
Sbjct:  370 RSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG 436          
BLAST of AJ308132 vs. SwissProt
Match: EF1A_MAIZE (Elongation factor 1-alpha OS=Zea mays GN=EF1A PE=3 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 2.046e-19
Identity = 48/67 (71.64%), Postives = 53/67 (79.10%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKM+PT   V E  ++YPPLGRFAVRDMRQTVAVG IKSVEKKDPTG
Sbjct:  370 RSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG 436          
BLAST of AJ308132 vs. SwissProt
Match: EF1A_TOBAC (Elongation factor 1-alpha OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 3.490e-19
Identity = 48/67 (71.64%), Postives = 53/67 (79.10%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKMIPT   V E  +EYPPLGRFAVRDMRQTVAVG IK+V+KKDPTG
Sbjct:  370 RSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG 436          
BLAST of AJ308132 vs. SwissProt
Match: EF1A_SOYBN (Elongation factor 1-alpha OS=Glycine max GN=TEFS1 PE=3 SV=2)

HSP 1 Score: 92.8189 bits (229), Expect = 5.952e-19
Identity = 48/67 (71.64%), Postives = 52/67 (77.61%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  G VKMIPT   V E  +EYPPLGRFAVRDMRQTVAVG IK+VEKKDPTG
Sbjct:  370 RSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 436          
BLAST of AJ308132 vs. SwissProt
Match: EF1A_ARATH (Elongation factor 1-alpha OS=Arabidopsis thaliana GN=A1 PE=1 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 5.952e-19
Identity = 48/67 (71.64%), Postives = 52/67 (77.61%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  GMVKM PT   V E  +EYPPLGRFAVRDMRQTVAVG IKSV+KKDPTG
Sbjct:  370 RSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG 436          
BLAST of AJ308132 vs. SwissProt
Match: EF1A2_HORVU (Elongation factor 1-alpha OS=Hordeum vulgare GN=BLT63 PE=1 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 7.774e-19
Identity = 48/67 (71.64%), Postives = 52/67 (77.61%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  G VKMIPT   V E  A+YPPLGRFAVRDMRQTVAVG IKSVEKK+PTG
Sbjct:  370 RSGKELEAAPKFLKNGDAGFVKMIPTKPMVVETFAQYPPLGRFAVRDMRQTVAVGVIKSVEKKEPTG 436          
BLAST of AJ308132 vs. SwissProt
Match: EF1A1_HORVU (Elongation factor 1-alpha OS=Hordeum vulgare PE=1 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 7.774e-19
Identity = 48/67 (71.64%), Postives = 52/67 (77.61%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  G VKMIPT   V E  A+YPPLGRFAVRDMRQTVAVG IKSVEKK+PTG
Sbjct:  370 RSGKELEAAPKFLKNGDAGFVKMIPTKPMVVETFAQYPPLGRFAVRDMRQTVAVGVIKSVEKKEPTG 436          
BLAST of AJ308132 vs. Medicago proteins
Match: IMGA|Medtr6g021800.1 (Elongation factor 1-alpha (AHRD V1 ***- Q9LN13_ARATH); contains Interpro domain(s) IPR004539 Translation elongation factor EF1A, eukaryotic and archaeal chr06_pseudomolecule_IMGAG_V3.5 4751975-4764664 E EGN_Mt100125 20100825)

HSP 1 Score: 93.5893 bits (231), Expect = 3.366e-20
Identity = 47/67 (70.15%), Postives = 53/67 (79.10%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  G++KM+PT   V E  AEYPPLGRFAVRDMRQTVAVG IK+VEKKDPTG
Sbjct:  370 RSGKEIEKEPKFLKNGDAGIIKMVPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKAVEKKDPTG 436          

HSP 2 Score: 93.5893 bits (231), Expect = 3.366e-20
Identity = 47/67 (70.15%), Postives = 53/67 (79.10%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  G++KM+PT   V E  AEYPPLGRFAVRDMRQTVAVG IK+VEKKDPTG
Sbjct:  910 RSGKEIEKEPKFLKNGDAGIIKMVPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKAVEKKDPTG 976          
BLAST of AJ308132 vs. Medicago proteins
Match: IMGA|Medtr1g095650.1 (Elongation factor 1-alpha (AHRD V1 ***- Q3LUM5_GOSHI); contains Interpro domain(s) IPR004539 Translation elongation factor EF1A, eukaryotic and archaeal chr01_pseudomolecule_IMGAG_V3.5 27444467-27440606 E EGN_Mt100125 20100825)

HSP 1 Score: 91.2781 bits (225), Expect = 1.671e-19
Identity = 46/67 (68.66%), Postives = 53/67 (79.10%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  G++KMIPT   V E  +EYPPLGRFAVRDMRQTVAVG IK+VEKKDP+G
Sbjct:  488 RSGKEIEKEPKFLKNGDAGIIKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKAVEKKDPSG 554          
BLAST of AJ308132 vs. Medicago proteins
Match: IMGA|Medtr1g013680.1 (Elongation factor 1-alpha (AHRD V1 ***- Q3LUM5_GOSHI); contains Interpro domain(s) IPR004539 Translation elongation factor EF1A, eukaryotic and archaeal chr01_pseudomolecule_IMGAG_V3.5 3476869-3479444 E EGN_Mt100125 20100825)

HSP 1 Score: 91.2781 bits (225), Expect = 1.671e-19
Identity = 46/67 (68.66%), Postives = 53/67 (79.10%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  G++KMIPT   V E  +EYPPLGRFAVRDMRQTVAVG IK+VEKKDP+G
Sbjct:  366 RSGKEIEKEPKFLKNGDAGIIKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKAVEKKDPSG 432          
BLAST of AJ308132 vs. Medicago proteins
Match: IMGA|Medtr4g019170.1 (Elongation factor 1-alpha (AHRD V1 ***- Q3LUM5_GOSHI); contains Interpro domain(s) IPR004539 Translation elongation factor EF1A, eukaryotic and archaeal chr04_pseudomolecule_IMGAG_V3.5 5037739-5035552 E EGN_Mt100125 20100825)

HSP 1 Score: 90.8929 bits (224), Expect = 2.182e-19
Identity = 46/67 (68.66%), Postives = 52/67 (77.61%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPTG 219
            RSG++     KFLKNG  G++KMIPT   V E  +EYPPLGRFAVRDMRQTVAVG IK VEKKDP+G
Sbjct:  370 RSGKEIEKEPKFLKNGDAGIIKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKGVEKKDPSG 436          
BLAST of AJ308132 vs. Medicago proteins
Match: IMGA|Medtr4g014810.1 (Elongation factor 1-alpha (AHRD V1 ***- Q3LUM5_GOSHI); contains Interpro domain(s) IPR004539 Translation elongation factor EF1A, eukaryotic and archaeal chr04_pseudomolecule_IMGAG_V3.5 3364412-3361380 E EGN_Mt100125 20100825)

HSP 1 Score: 86.6557 bits (213), Expect = 4.115e-18
Identity = 44/65 (67.69%), Postives = 50/65 (76.92%), Query Frame = 1
Query:   22 RSGRDXXXX-KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDP 213
            RSG++     KFLKNG  G++KMIPT   V E  +EYPPLGRFAVRDMRQTVAVG IK VEKK+P
Sbjct:  370 RSGKEIEKEPKFLKNGDAGIIKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKGVEKKEP 434          
BLAST of AJ308132 vs. Medicago proteins
Match: IMGA|Medtr8g014590.1 (Elongation factor 1-alpha (AHRD V1 ***- Q3LUM5_GOSHI); contains Interpro domain(s) IPR004539 Translation elongation factor EF1A, eukaryotic and archaeal chr08_pseudomolecule_IMGAG_V3.5 3184748-3179440 E EGN_Mt100125 20100825)

HSP 1 Score: 77.7962 bits (190), Expect = 1.912e-15
Identity = 37/55 (67.27%), Postives = 44/55 (80.00%), Query Frame = 1
Query:   49 KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDP 213
            KFLKNG  G++KMIPT   V E  + YP LGRFAVRD+R+TVAVG IK+V+KKDP
Sbjct:  382 KFLKNGDAGIIKMIPTKPMVVETFSNYPSLGRFAVRDIRRTVAVGVIKAVKKKDP 436          
BLAST of AJ308132 vs. Medicago proteins
Match: IMGA|Medtr1g101870.1 (Elongation factor 1-alpha (AHRD V1 *-*- Q3LUL9_GOSHI); contains Interpro domain(s) IPR004539 Translation elongation factor EF1A, eukaryotic and archaeal chr01_pseudomolecule_IMGAG_V3.5 30156055-30166064 E EGN_Mt100125 20100825)

HSP 1 Score: 72.7886 bits (177), Expect = 6.149e-14
Identity = 35/55 (63.64%), Postives = 41/55 (74.55%), Query Frame = 1
Query:   49 KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDP 213
            KFL +G  G++KMIPT   V E  + YPPLGRF VRD  QTVAVG IK+V+KKDP
Sbjct:  375 KFLMSGDTGIIKMIPTKPMVVEPFSLYPPLGRFVVRDWHQTVAVGVIKAVKKKDP 429          
BLAST of AJ308132 vs. Medicago proteins
Match: IMGA|Medtr1g095710.1 (Elongation factor 1-alpha (AHRD V1 *-*- Q6LAA4_HORVU); contains Interpro domain(s) IPR004160 Translation elongation factor EFTu/EF1A, C-terminal chr01_pseudomolecule_IMGAG_V3.5 27479995-27468750 H EGN_Mt100125 20100825)

HSP 1 Score: 69.707 bits (169), Expect = 5.206e-13
Identity = 33/51 (64.71%), Postives = 38/51 (74.51%), Query Frame = 1
Query:   49 KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVE 201
            KFL NG  G++KMIPT   V E  +EYPPLGRF +RD RQTVAVG I +VE
Sbjct:  951 KFLMNGDAGIIKMIPTKPMVVETFSEYPPLGRFTIRDKRQTVAVGVITAVE 1001          
BLAST of AJ308132 vs. Medicago proteins
Match: IMGA|Medtr5g037350.1 (Elongation factor 1-alpha (AHRD V1 *-*- Q3LUM5_GOSHI); contains Interpro domain(s) IPR004539 Translation elongation factor EF1A, eukaryotic and archaeal chr05_pseudomolecule_IMGAG_V3.5 15926206-15913026 E EGN_Mt100125 20100825)

HSP 1 Score: 68.5514 bits (166), Expect = 1.160e-12
Identity = 33/56 (58.93%), Postives = 39/56 (69.64%), Query Frame = 1
Query:   49 KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEKKDPT 216
            KFLK G  G+++MIPT   V E  +EYP LGRF VRD  QTVA+G I  V KKDP+
Sbjct:  421 KFLKKGDGGIIQMIPTKPMVVETFSEYPSLGRFIVRDTHQTVAIGIILVVNKKDPS 476          
BLAST of AJ308132 vs. Medicago proteins
Match: IMGA|Medtr2g037420.1 (Elongation factor 1-alpha (AHRD V1 ***- C4JA47_MAIZE); contains Interpro domain(s) IPR004160 Translation elongation factor EFTu/EF1A, C-terminal chr02_pseudomolecule_IMGAG_V3.5 13633802-13630740 H EGN_Mt100125 20100825)

HSP 1 Score: 68.5514 bits (166), Expect = 1.160e-12
Identity = 36/52 (69.23%), Postives = 38/52 (73.08%), Query Frame = 1
Query:   49 KFLKNGXXGMVKMIPTXXXVXEXXAEYPPLGRFAVRDMRQTVAVGXIKSVEK 204
            K LKNG  G+VKMIP    V E   EYP LGRFAVRDMRQTVAVG I SV+K
Sbjct:  346 KSLKNGDAGIVKMIPMKPMVVEGINEYPSLGRFAVRDMRQTVAVGVIMSVKK 397          
The following BLAST results are available for this feature:
BLAST of AJ308132 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
Q43565_NARPS1.075e-1874.63Elongation factor (Fragment) OS=Narcissus pseudona... [more]
Q9SPA1_LILLO1.404e-1874.63Elongation factor 1-alpha OS=Lilium longiflorum PE... [more]
Q9FYV3_SACOF1.404e-1874.63Elongation factor 1-alpha OS=Saccharum officinarum... [more]
Q58I24_ACTDE1.404e-1874.63Elongation factor 1-alpha OS=Actinidia deliciosa P... [more]
Q3LUM1_GOSHI1.404e-1874.63Elongation factor 1-alpha OS=Gossypium hirsutum GN... [more]
A8CYN3_GERHY1.404e-1874.63Elongation factor 1-alpha OS=Gerbera hybrida PE=2 ... [more]
Q8SAT2_SACOF1.833e-1873.13Elongation factor 1-alpha OS=Saccharum officinarum... [more]
Q8SAT1_SACOF1.833e-1873.13Elongation factor 1-alpha (Fragment) OS=Saccharum ... [more]
Q3LUM5_GOSHI1.833e-1873.13Elongation factor 1-alpha OS=Gossypium hirsutum GN... [more]
B6UHJ4_MAIZE1.833e-1873.13Elongation factor 1-alpha OS=Zea mays PE=2 SV=1[more]
back to top
BLAST of AJ308132 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Swissprot)
Total hits: 10
Match NameE-valueIdentityDescription
EF1A_VICFA3.100e-2076.12Elongation factor 1-alpha OS=Vicia faba PE=2 SV=1[more]
EF1A_PEA3.100e-2076.12Elongation factor 1-alpha OS=Pisum sativum PE=2 SV... [more]
EF1A_ORYSJ1.539e-1973.13Elongation factor 1-alpha OS=Oryza sativa subsp. j... [more]
EF1A_SOLLC2.010e-1971.64Elongation factor 1-alpha OS=Solanum lycopersicum ... [more]
EF1A_MAIZE2.010e-1971.64Elongation factor 1-alpha OS=Zea mays GN=EF1A PE=3... [more]
EF1A_TOBAC3.428e-1971.64Elongation factor 1-alpha OS=Nicotiana tabacum PE=... [more]
EF1A_SOYBN5.847e-1971.64Elongation factor 1-alpha OS=Glycine max GN=TEFS1 ... [more]
EF1A_ARATH5.847e-1971.64Elongation factor 1-alpha OS=Arabidopsis thaliana ... [more]
EF1A2_HORVU7.636e-1971.64Elongation factor 1-alpha OS=Hordeum vulgare GN=BL... [more]
EF1A1_HORVU7.636e-1971.64Elongation factor 1-alpha OS=Hordeum vulgare PE=1 ... [more]
back to top
BLAST of AJ308132 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide)
Total hits: 8
Match NameE-valueIdentityDescription
AT5G60390.36.631e-2071.64| Symbols: | GTP binding Elongation factor Tu fam... [more]
AT5G60390.16.631e-2071.64| Symbols: | GTP binding Elongation factor Tu fam... [more]
AT1G07930.26.631e-2071.64| Symbols: | GTP binding Elongation factor Tu fam... [more]
AT1G07940.26.631e-2071.64| Symbols: | GTP binding Elongation factor Tu fam... [more]
AT1G07940.16.631e-2071.64| Symbols: | GTP binding Elongation factor Tu fam... [more]
AT1G07930.16.631e-2071.64| Symbols: | GTP binding Elongation factor Tu fam... [more]
AT1G07920.16.631e-2071.64| Symbols: | GTP binding Elongation factor Tu fam... [more]
AT1G35550.18.389e-1563.16| Symbols: | elongation factor Tu C-terminal doma... [more]
back to top
BLAST of AJ308132 vs. TAIR peptide
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs TAIR 10 peptide)
Total hits: 8
Match NameE-valueIdentityDescription
AT5G60390.36.631e-2071.64| Symbols: | GTP binding Elongation factor Tu fam... [more]
AT5G60390.16.631e-2071.64| Symbols: | GTP binding Elongation factor Tu fam... [more]
AT1G07930.26.631e-2071.64| Symbols: | GTP binding Elongation factor Tu fam... [more]
AT1G07940.26.631e-2071.64| Symbols: | GTP binding Elongation factor Tu fam... [more]
AT1G07940.16.631e-2071.64| Symbols: | GTP binding Elongation factor Tu fam... [more]
AT1G07930.16.631e-2071.64| Symbols: | GTP binding Elongation factor Tu fam... [more]
AT1G07920.16.631e-2071.64| Symbols: | GTP binding Elongation factor Tu fam... [more]
AT1G35550.18.389e-1563.16| Symbols: | elongation factor Tu C-terminal doma... [more]
back to top
BLAST of AJ308132 vs. TrEMBL
Analysis Date: 2011-04-27 (Homology Analysis: Pisum sativum unigene v2 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
Q43565_NARPS1.344e-1874.63Elongation factor (Fragment) OS=Narcissus pseudona... [more]
Q9SPA1_LILLO1.755e-1874.63Elongation factor 1-alpha OS=Lilium longiflorum PE... [more]
Q9FYV3_SACOF1.755e-1874.63Elongation factor 1-alpha OS=Saccharum officinarum... [more]
Q58I24_ACTDE1.755e-1874.63Elongation factor 1-alpha OS=Actinidia deliciosa P... [more]
Q3LUM1_GOSHI1.755e-1874.63Elongation factor 1-alpha OS=Gossypium hirsutum GN... [more]
A8CYN3_GERHY1.755e-1874.63Elongation factor 1-alpha OS=Gerbera hybrida PE=2 ... [more]
Q8SAT2_SACOF2.292e-1873.13Elongation factor 1-alpha OS=Saccharum officinarum... [more]
Q8SAT1_SACOF2.292e-1873.13Elongation factor 1-alpha (Fragment) OS=Saccharum ... [more]
Q3LUM5_GOSHI2.292e-1873.13Elongation factor 1-alpha OS=Gossypium hirsutum GN... [more]
B6UHJ4_MAIZE2.292e-1873.13Elongation factor 1-alpha OS=Zea mays PE=2 SV=1[more]
back to top
BLAST of AJ308132 vs. Lotus protein
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Lotus proteins)
Total hits: 4
Match NameE-valueIdentityDescription
chr1.CM0001.850.r2.m6.266e-2173.13+ phase: 0 [more]
chr5.CM0909.990.r2.m1.069e-2073.13- phase: 0 [more]
chr2.LjT12G08.20.r2.m5.305e-2071.64- phase: 0 [more]
chr1.CM0192.300.r2.m1.266e-1371.43- phase: 0 /est[more]
back to top
BLAST of AJ308132 vs. Soybean peptides
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Soybean peptides)
Total hits: 7
Match NameE-valueIdentityDescription
Glyma19g07240.2|PACid:163121451.136e-2074.63[more]
Glyma19g07240.1|PACid:163121441.136e-2074.63[more]
Glyma05g24110.1|PACid:162594411.483e-2073.13[more]
Glyma10g35700.1|PACid:162810832.530e-2073.13[more]
Glyma16g07350.1|PACid:163017825.636e-2073.13[more]
Glyma17g23900.1|PACid:163063649.614e-2071.64[more]
Glyma05g11630.1|PACid:162588599.614e-2071.64[more]
back to top
BLAST of AJ308132 vs. SwissProt
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Swissprot)
Total hits: 10
Match NameE-valueIdentityDescription
EF1A_VICFA3.156e-2076.12Elongation factor 1-alpha OS=Vicia faba PE=2 SV=1[more]
EF1A_PEA3.156e-2076.12Elongation factor 1-alpha OS=Pisum sativum PE=2 SV... [more]
EF1A_ORYSJ1.566e-1973.13Elongation factor 1-alpha OS=Oryza sativa subsp. j... [more]
EF1A_SOLLC2.046e-1971.64Elongation factor 1-alpha OS=Solanum lycopersicum ... [more]
EF1A_MAIZE2.046e-1971.64Elongation factor 1-alpha OS=Zea mays GN=EF1A PE=3... [more]
EF1A_TOBAC3.490e-1971.64Elongation factor 1-alpha OS=Nicotiana tabacum PE=... [more]
EF1A_SOYBN5.952e-1971.64Elongation factor 1-alpha OS=Glycine max GN=TEFS1 ... [more]
EF1A_ARATH5.952e-1971.64Elongation factor 1-alpha OS=Arabidopsis thaliana ... [more]
EF1A2_HORVU7.774e-1971.64Elongation factor 1-alpha OS=Hordeum vulgare GN=BL... [more]
EF1A1_HORVU7.774e-1971.64Elongation factor 1-alpha OS=Hordeum vulgare PE=1 ... [more]
back to top
BLAST of AJ308132 vs. Medicago proteins
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Medicago proteins)
Total hits: 10
Match NameE-valueIdentityDescription
IMGA|Medtr6g021800.13.366e-2070.15Elongation factor 1-alpha (AHRD V1 ***- Q9LN13_ARA... [more]
IMGA|Medtr1g095650.11.671e-1968.66Elongation factor 1-alpha (AHRD V1 ***- Q3LUM5_GOS... [more]
IMGA|Medtr1g013680.11.671e-1968.66Elongation factor 1-alpha (AHRD V1 ***- Q3LUM5_GOS... [more]
IMGA|Medtr4g019170.12.182e-1968.66Elongation factor 1-alpha (AHRD V1 ***- Q3LUM5_GOS... [more]
IMGA|Medtr4g014810.14.115e-1867.69Elongation factor 1-alpha (AHRD V1 ***- Q3LUM5_GOS... [more]
IMGA|Medtr8g014590.11.912e-1567.27Elongation factor 1-alpha (AHRD V1 ***- Q3LUM5_GOS... [more]
IMGA|Medtr1g101870.16.149e-1463.64Elongation factor 1-alpha (AHRD V1 *-*- Q3LUL9_GOS... [more]
IMGA|Medtr1g095710.15.206e-1364.71Elongation factor 1-alpha (AHRD V1 *-*- Q6LAA4_HOR... [more]
IMGA|Medtr5g037350.11.160e-1258.93Elongation factor 1-alpha (AHRD V1 *-*- Q3LUM5_GOS... [more]
IMGA|Medtr2g037420.11.160e-1269.23Elongation factor 1-alpha (AHRD V1 ***- C4JA47_MAI... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v2
Date Performed: 2011-04-27
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004160Translation elongation factor EFTu/EF1A, C-terminalPFAMPF03143GTP_EFTU_D3coord: 10..65
score: 5.3
IPR009001Translation elongation factor EF1A/initiation factor IF2gamma, C-terminalSUPERFAMILY50465EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domaincoord: 16..67
score: 1.3
NoneNo IPR availableGENE3D2.40.30.10no descriptioncoord: 7..67
score: 6.3
NoneNo IPR availableSEGsegsegcoord: 1..7
score: NAcoord: 73..83
score
NoneNo IPR availableSEGsegsegcoord: 36..47
score
NoneNo IPR availableSEGsegsegcoord: 16..28
score
NoneNo IPR availableSEGsegsegcoord: 82..94
score
NoneNo IPR availableSEGsegsegcoord: 50..61
score: NAcoord: 70..84
score

Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004160Translation elongation factor EFTu/EF1A, C-terminalPFAMPF03143GTP_EFTU_D3coord: 10..65
score: 5.3
IPR009001Translation elongation factor EF1A/initiation factor IF2gamma, C-terminalSUPERFAMILY50465EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domaincoord: 16..67
score: 1.3
NoneNo IPR availableGENE3D2.40.30.10no descriptioncoord: 7..67
score: 6.3
NoneNo IPR availableSEGsegsegcoord: 1..7
score: NAcoord: 73..83
score
NoneNo IPR availableSEGsegsegcoord: 36..47
score
NoneNo IPR availableSEGsegsegcoord: 16..28
score
NoneNo IPR availableSEGsegsegcoord: 82..94
score
NoneNo IPR availableSEGsegsegcoord: 50..61
score: NAcoord: 70..84
score

Properties
Property NameValue
Singlet in analysisPisum sativum unigene v2
Singlet in analysisPisum sativum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>AJ308132 ID=AJ308132|Name=AJ308132|organism=Pisum sativum|type=EST|length=407bp
TAGCGTRAAAMAMCGAGGYGGCGATCTGGVAGGGATTVVCMVVMGCHCAA
GTTTTTGAAGAATGGHGAHRCCGGTATGGTTAAGATGATTCCAACCAAVV
MCMYGGTSVTGGAAAMHWTTGCTGAGTATCCTCCHCTTGGACGTTTTGCT
GTGAGGGACATGAGACAAACTGTTGCHGTCGGAGNMATCAAGAGTGTGGA
GAAGAAGGACCCAACTGGAGCCAAGGTCACCAAAGCTGCAGCCAAGAAGA
AGTGATTTCACTCCATGGTTGCTTCTGCACAAGTTGTTCCTTTATAGKAG
TCTATCTTTCCAGTTTAATTTTGAAGTTTTTGCCTGTTTCATTAAACTAA
ACTTACAAAACTGGGTTCTYGCTCSGCGGTGGKCCAWTTTCCATTTTGTG
ADTTTCC
back to top
Annotated Terms
The following terms have been associated with this EST:
Vocabulary: Molecular Function
TermDefinition
GO:0005525GTP binding
Vocabulary: INTERPRO
TermDefinition
IPR004160Transl_elong_EFTu/EF1A_C
IPR009001Transl_elong_EF1A/Init_IF2_C