CD858730

EST Overview
NameCD858730
Unique NameCD858730
TypeEST
OrganismPisum sativum (pea)
Sequence length573
Libraries
Library NameType
LIBEST_013996 CEcdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Pisum sativum unigene v1Pisum sativum unigene v1EST
Homology
BLAST of CD858730 vs. TrEMBL
Match: B9IKA5_POPTR (ZIP transporter OS=Populus trichocarpa GN=POPTRDRAFT_835760 PE=4 SV=1)

HSP 1 Score: 256.914 bits (655), Expect = 7.091e-67
Identity = 133/158 (84.18%), Postives = 139/158 (87.97%), Query Frame = -1
Query:  100 RHVVVSQVLELGIVSHSVIIGLSLGVSQSPCAIRPLIAALSFHQFFEGFALGGCISQAQFKASSATIMACFFALXXXXXXXXXXXIASVYNPYSPGALIAEGILDSLSAGILVYMALVDLIAADFLSKRMSCNFRLQLVSYCMLFLGAGLMSSLAIWA 573
            RHVVVSQ+LELGI+SHSVIIGLSLGVSQSPC IRPLIAALSFHQFFEGFALGGCISQAQFK  S TIMACFFA+           I+S YNP SP AL AEGILDSLSAGILVYMALVDLIAADFLSKRMSCNFRLQ+VSYCMLFLGAGLMSSLA+WA
Sbjct:  236 RHVVVSQILELGILSHSVIIGLSLGVSQSPCTIRPLIAALSFHQFFEGFALGGCISQAQFKTLSTTIMACFFAITTPAGIGIGTAISSFYNPNSPRALAAEGILDSLSAGILVYMALVDLIAADFLSKRMSCNFRLQVVSYCMLFLGAGLMSSLAVWA 393          
BLAST of CD858730 vs. TrEMBL
Match: B9RRS3_RICCO (Zinc/iron transporter, putative OS=Ricinus communis GN=RCOM_0797420 PE=4 SV=1)

HSP 1 Score: 255.373 bits (651), Expect = 2.063e-66
Identity = 132/158 (83.54%), Postives = 141/158 (89.24%), Query Frame = -1
Query:  100 RHVVVSQVLELGIVSHSVIIGLSLGVSQSPCAIRPLIAALSFHQFFEGFALGGCISQAQFKASSATIMACFFALXXXXXXXXXXXIASVYNPYSPGALIAEGILDSLSAGILVYMALVDLIAADFLSKRMSCNFRLQLVSYCMLFLGAGLMSSLAIWA 573
            RHVVVSQVLELGIVSHSVIIGLSLGVS+SPC IRPLIAALSFHQFFEGFALGGCISQAQFK  SAT+MACFFA+           IAS YNP+S GALIAEGILDSLSAGILVYMALVDL+AADFLSKRMSCNFRLQ+VSY MLFLGAG+M++LAIWA
Sbjct:  262 RHVVVSQVLELGIVSHSVIIGLSLGVSESPCTIRPLIAALSFHQFFEGFALGGCISQAQFKTLSATLMACFFAITTPTGIGIGTAIASFYNPHSQGALIAEGILDSLSAGILVYMALVDLVAADFLSKRMSCNFRLQVVSYFMLFLGAGMMAALAIWA 419          
BLAST of CD858730 vs. TrEMBL
Match: D7KLL3_ARALY (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_888393 PE=4 SV=1)

HSP 1 Score: 251.906 bits (642), Expect = 2.281e-65
Identity = 129/158 (81.65%), Postives = 139/158 (87.97%), Query Frame = -1
Query:  100 RHVVVSQVLELGIVSHSVIIGLSLGVSQSPCAIRPLIAALSFHQFFEGFALGGCISQAQFKASSATIMACFFALXXXXXXXXXXXIASVYNPYSPGALIAEGILDSLSAGILVYMALVDLIAADFLSKRMSCNFRLQLVSYCMLFLGAGLMSSLAIWA 573
            RHVVVSQ+LELGIVSHS+IIGLSLGVSQSPC IRPLIAALSFHQFFEGFALGGCISQAQF+  SATIMACFFAL           +AS +N +SPGAL+ EGILDSLSAGILVYMALVDLIAADFLSKRMSCN RLQ+VSY MLFLGAGLMS+LA+WA
Sbjct:  258 RHVVVSQILELGIVSHSIIIGLSLGVSQSPCTIRPLIAALSFHQFFEGFALGGCISQAQFRNKSATIMACFFALTTPIGIGIGTAVASSFNSHSPGALVTEGILDSLSAGILVYMALVDLIAADFLSKRMSCNVRLQVVSYIMLFLGAGLMSALAVWA 415          
BLAST of CD858730 vs. TrEMBL
Match: Q6VM17_MEDTR (Metal transport protein OS=Medicago truncatula GN=ZIP5 PE=2 SV=1)

HSP 1 Score: 251.521 bits (641), Expect = 2.979e-65
Identity = 128/158 (81.01%), Postives = 140/158 (88.61%), Query Frame = -1
Query:  100 RHVVVSQVLELGIVSHSVIIGLSLGVSQSPCAIRPLIAALSFHQFFEGFALGGCISQAQFKASSATIMACFFALXXXXXXXXXXXIASVYNPYSPGALIAEGILDSLSAGILVYMALVDLIAADFLSKRMSCNFRLQLVSYCMLFLGAGLMSSLAIWA 573
            RHVVVSQVLELGIVSHS+IIGLSLGVSQSPC +RPLIAALSFHQFFEGFALGGCIS+A+FK SSATIMACFFAL           +AS +NPYSPGALI EGILDSLSAGILVYMALVDLIAADFLSK+M C+ RLQ+VS+C+LFLGAG MSSLA+WA
Sbjct:  217 RHVVVSQVLELGIVSHSLIIGLSLGVSQSPCTMRPLIAALSFHQFFEGFALGGCISEARFKTSSATIMACFFALTTPLGVAIGTLVASNFNPYSPGALITEGILDSLSAGILVYMALVDLIAADFLSKKMRCSLRLQIVSFCLLFLGAGSMSSLALWA 374          
BLAST of CD858730 vs. TrEMBL
Match: Q5CCL8_THLJA (ZIP family metal transporter OS=Thlaspi japonicum GN=TjZNT1 PE=2 SV=1)

HSP 1 Score: 251.521 bits (641), Expect = 2.979e-65
Identity = 130/158 (82.28%), Postives = 138/158 (87.34%), Query Frame = -1
Query:  100 RHVVVSQVLELGIVSHSVIIGLSLGVSQSPCAIRPLIAALSFHQFFEGFALGGCISQAQFKASSATIMACFFALXXXXXXXXXXXIASVYNPYSPGALIAEGILDSLSAGILVYMALVDLIAADFLSKRMSCNFRLQLVSYCMLFLGAGLMSSLAIWA 573
            RHVVVSQ+LELGIVSHS+IIGLSLGVSQSPC IRPLIAALSFHQFFEGFALGGCISQAQFK  SA IMACFFAL           +AS +N +SPGAL+ EGILDSLSAGILVYMALVDLIAADFLSKRMSCN RLQ+VSY MLFLGAGLMS+LAIWA
Sbjct:  227 RHVVVSQILELGIVSHSIIIGLSLGVSQSPCTIRPLIAALSFHQFFEGFALGGCISQAQFKNKSAIIMACFFALTTPIGIGIGTAVASSFNSHSPGALVTEGILDSLSAGILVYMALVDLIAADFLSKRMSCNLRLQVVSYVMLFLGAGLMSALAIWA 384          
BLAST of CD858730 vs. TrEMBL
Match: Q9FPW7_THLCA (Putative Zn transporter ZNT4 OS=Thlaspi caerulescens GN=ZNT4 PE=2 SV=1)

HSP 1 Score: 249.98 bits (637), Expect = 8.668e-65
Identity = 129/157 (82.17%), Postives = 138/157 (87.90%), Query Frame = -1
Query:  103 RHVVVSQVLELGIVSHSVIIGLSLGVSQSPCAIRPLIAALSFHQFFEGFALGGCISQAQFKASSATIMACFFALXXXXXXXXXXXIASVYNPYSPGALIAEGILDSLSAGILVYMALVDLIAADFLSKRMSCNFRLQLVSYCMLFLGAGLMSSLAIW 573
            RHVVVSQVLELGIVSHS+IIG+SLGVSQSPC IRPLIAALSFHQFFEGFALGGCISQAQFK  SATIMACFFAL           +AS +N +S GAL+ EGILDSLSAGILVYMALVDLIAADFLSKRMSCNFRLQ+VSY +LFLG+GLMSSLAIW
Sbjct:  229 RHVVVSQVLELGIVSHSIIIGISLGVSQSPCTIRPLIAALSFHQFFEGFALGGCISQAQFKNKSATIMACFFALTTPISIGIGTVVASSFNAHSVGALVTEGILDSLSAGILVYMALVDLIAADFLSKRMSCNFRLQIVSYLLLFLGSGLMSSLAIW 385          
BLAST of CD858730 vs. TrEMBL
Match: Q93XE7_THLCA (ZIP-like zinc transporter OS=Thlaspi caerulescens GN=ZNT2 PE=2 SV=1)

HSP 1 Score: 249.98 bits (637), Expect = 8.668e-65
Identity = 129/157 (82.17%), Postives = 138/157 (87.90%), Query Frame = -1
Query:  103 RHVVVSQVLELGIVSHSVIIGLSLGVSQSPCAIRPLIAALSFHQFFEGFALGGCISQAQFKASSATIMACFFALXXXXXXXXXXXIASVYNPYSPGALIAEGILDSLSAGILVYMALVDLIAADFLSKRMSCNFRLQLVSYCMLFLGAGLMSSLAIW 573
            RHVVVSQVLELGIVSHS+IIG+SLGVSQSPC IRPLIAALSFHQFFEGFALGGCISQAQFK  SATIMACFFAL           +AS +N +S GAL+ EGILDSLSAGILVYMALVDLIAADFLSKRMSCNFRLQ+VSY +LFLG+GLMSSLAIW
Sbjct:  265 RHVVVSQVLELGIVSHSIIIGISLGVSQSPCTIRPLIAALSFHQFFEGFALGGCISQAQFKNKSATIMACFFALTTPISIGIGTVVASSFNAHSVGALVTEGILDSLSAGILVYMALVDLIAADFLSKRMSCNFRLQIVSYLLLFLGSGLMSSLAIW 421          
BLAST of CD858730 vs. TrEMBL
Match: D7KW68_ARALY (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_315258 PE=4 SV=1)

HSP 1 Score: 249.98 bits (637), Expect = 8.668e-65
Identity = 130/158 (82.28%), Postives = 138/158 (87.34%), Query Frame = -1
Query:  100 RHVVVSQVLELGIVSHSVIIGLSLGVSQSPCAIRPLIAALSFHQFFEGFALGGCISQAQFKASSATIMACFFALXXXXXXXXXXXIASVYNPYSPGALIAEGILDSLSAGILVYMALVDLIAADFLSKRMSCNFRLQLVSYCMLFLGAGLMSSLAIWA 573
            RH+VVSQVLELGIVSHS+IIGLSLGVSQSPC IRPLIAALSFHQFFEGFALGGCISQAQF+  SATIMACFFAL           +AS +N +S GALI EGILDSLSAGILVYMALVDLIAADFLS +MSCNFRLQ+VSY MLFLGAGLMSSLAIWA
Sbjct:  272 RHIVVSQVLELGIVSHSIIIGLSLGVSQSPCTIRPLIAALSFHQFFEGFALGGCISQAQFRNKSATIMACFFALTTPIGIGIGTAVASSFNSHSVGALITEGILDSLSAGILVYMALVDLIAADFLSTKMSCNFRLQIVSYIMLFLGAGLMSSLAIWA 429          
BLAST of CD858730 vs. TrEMBL
Match: Q9M7J1_THLCA (Zn and Cd transporter ZNT1 OS=Thlaspi caerulescens GN=ZNT1 PE=2 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 1.132e-64
Identity = 129/158 (81.65%), Postives = 137/158 (86.71%), Query Frame = -1
Query:  100 RHVVVSQVLELGIVSHSVIIGLSLGVSQSPCAIRPLIAALSFHQFFEGFALGGCISQAQFKASSATIMACFFALXXXXXXXXXXXIASVYNPYSPGALIAEGILDSLSAGILVYMALVDLIAADFLSKRMSCNFRLQLVSYCMLFLGAGLMSSLAIWA 573
            RHVVVSQ+LELGIVSHS+IIGLSLGVSQSPC IRPLIAALSFHQFFEGFALGGCISQAQFK  SA IMACFFAL           +AS +N +SPGAL+ EGILDSLSAGIL YMALVDLIAADFLSKRMSCN RLQ+VSY MLFLGAGLMS+LAIWA
Sbjct:  221 RHVVVSQILELGIVSHSIIIGLSLGVSQSPCTIRPLIAALSFHQFFEGFALGGCISQAQFKNKSAIIMACFFALTAPIGIGIGTAVASSFNSHSPGALVTEGILDSLSAGILTYMALVDLIAADFLSKRMSCNVRLQVVSYVMLFLGAGLMSALAIWA 378          
BLAST of CD858730 vs. TrEMBL
Match: Q93XE8_THLCA (ZIP-like zinc transporter OS=Thlaspi caerulescens GN=ZNT1-LC PE=2 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 1.132e-64
Identity = 129/158 (81.65%), Postives = 137/158 (86.71%), Query Frame = -1
Query:  100 RHVVVSQVLELGIVSHSVIIGLSLGVSQSPCAIRPLIAALSFHQFFEGFALGGCISQAQFKASSATIMACFFALXXXXXXXXXXXIASVYNPYSPGALIAEGILDSLSAGILVYMALVDLIAADFLSKRMSCNFRLQLVSYCMLFLGAGLMSSLAIWA 573
            RHVVVSQ+LELGIVSHS+IIGLSLGVSQSPC IRPLIAALSFHQFFEGFALGGCISQAQFK  SA IMACFFAL           +AS +N +SPGAL+ EGILDSLSAGIL YMALVDLIAADFLSKRMSCN RLQ+VSY MLFLGAGLMS+LAIWA
Sbjct:  251 RHVVVSQILELGIVSHSIIIGLSLGVSQSPCTIRPLIAALSFHQFFEGFALGGCISQAQFKNKSAIIMACFFALTAPIGIGIGTAVASSFNSHSPGALVTEGILDSLSAGILTYMALVDLIAADFLSKRMSCNVRLQVVSYVMLFLGAGLMSALAIWA 408          
BLAST of CD858730 vs. SwissProt
Match: ZIP4_ARATH (Zinc transporter 4, chloroplastic OS=Arabidopsis thaliana GN=ZIP4 PE=2 SV=1)

HSP 1 Score: 252.677 bits (644), Expect = 9.653e-67
Identity = 130/158 (82.28%), Postives = 139/158 (87.97%), Query Frame = -1
Query:  100 RHVVVSQVLELGIVSHSVIIGLSLGVSQSPCAIRPLIAALSFHQFFEGFALGGCISQAQFKASSATIMACFFALXXXXXXXXXXXIASVYNPYSPGALIAEGILDSLSAGILVYMALVDLIAADFLSKRMSCNFRLQLVSYCMLFLGAGLMSSLAIWA 573
            RHVVVSQ+LELGIVSHS+IIGLSLGVSQSPC IRPLIAALSFHQFFEGFALGGCISQAQF+  SATIMACFFAL           +AS +N +SPGAL+ EGILDSLSAGILVYMALVDLIAADFLSKRMSCN RLQ+VSY MLFLGAGLMS+LAIWA
Sbjct:  217 RHVVVSQILELGIVSHSIIIGLSLGVSQSPCTIRPLIAALSFHQFFEGFALGGCISQAQFRNKSATIMACFFALTTPLGIGIGTAVASSFNSHSPGALVTEGILDSLSAGILVYMALVDLIAADFLSKRMSCNLRLQVVSYVMLFLGAGLMSALAIWA 374          
BLAST of CD858730 vs. SwissProt
Match: IRT3_ARATH (Fe(2+) transport protein 3, chloroplastic OS=Arabidopsis thaliana GN=IRT3 PE=2 SV=2)

HSP 1 Score: 247.669 bits (631), Expect = 3.105e-65
Identity = 128/158 (81.01%), Postives = 137/158 (86.71%), Query Frame = -1
Query:  100 RHVVVSQVLELGIVSHSVIIGLSLGVSQSPCAIRPLIAALSFHQFFEGFALGGCISQAQFKASSATIMACFFALXXXXXXXXXXXIASVYNPYSPGALIAEGILDSLSAGILVYMALVDLIAADFLSKRMSCNFRLQLVSYCMLFLGAGLMSSLAIWA 573
            RH+VVSQVLELGIVSHS+IIGLSLGVSQSPC IRPLIAALSFHQFFEGFALGGCISQAQF+  SATIMACFFAL           +AS +N +S GAL+ EGILDSLSAGILVYMALVDLIAADFLS +M CNFRLQ+VSY MLFLGAGLMSSLAIWA
Sbjct:  232 RHIVVSQVLELGIVSHSIIIGLSLGVSQSPCTIRPLIAALSFHQFFEGFALGGCISQAQFRNKSATIMACFFALTTPIGIGIGTAVASSFNSHSVGALVTEGILDSLSAGILVYMALVDLIAADFLSTKMRCNFRLQIVSYVMLFLGAGLMSSLAIWA 389          
BLAST of CD858730 vs. SwissProt
Match: ZIP9_ARATH (Zinc transporter 9 OS=Arabidopsis thaliana GN=ZIP9 PE=2 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 1.397e-57
Identity = 111/158 (70.25%), Postives = 131/158 (82.91%), Query Frame = -1
Query:  100 RHVVVSQVLELGIVSHSVIIGLSLGVSQSPCAIRPLIAALSFHQFFEGFALGGCISQAQFKASSATIMACFFALXXXXXXXXXXXIASVYNPYSPGALIAEGILDSLSAGILVYMALVDLIAADFLSKRMSCNFRLQLVSYCMLFLGAGLMSSLAIWA 573
            RHVVVSQ+LE+GIVSHS+IIG+SLGVS SPC IRPL+ ALSFHQFFEGFALGGC+++A+     + +MA FFA+           IAS YN YS  AL+AEG+LDSLSAGILVYMALVDLIAADFLSK+MS +FR+Q+VSYC LFLGAG+MS+LAIWA
Sbjct:  187 RHVVVSQILEMGIVSHSIIIGISLGVSHSPCTIRPLLLALSFHQFFEGFALGGCVAEARLTPRGSAMMAFFFAITTPIGVAVGTAIASSYNSYSVAALVAEGVLDSLSAGILVYMALVDLIAADFLSKKMSVDFRVQVVSYCFLFLGAGMMSALAIWA 344          
BLAST of CD858730 vs. SwissProt
Match: ZIP3_ARATH (Zinc transporter 3 OS=Arabidopsis thaliana GN=ZIP3 PE=2 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 2.647e-40
Identity = 86/155 (55.48%), Postives = 110/155 (70.97%), Query Frame = -1
Query:  100 VVSQVLELGIVSHSVIIGLSLGVSQSPCAIRPLIAALSFHQFFEGFALGGCISQAQFKASSATIMACFFALXXXXXXXXXXXIASVYNPYSPGALIAEGILDSLSAGILVYMALVDLIAADFLSKRMSCNFRLQLVSYCMLFLGAGLMSSLAIWA 564
            V++QVLELGI+ HSV+IG+SLG SQSP A + L  AL FHQ FEG  LGGCI+Q +FK  S TIM+ FFA+           IA+ Y+  SP ALI +G+L++ SAGIL+YM+LVDL+AADF   +M  N  LQ++++  L LGAGLMS LA WA
Sbjct:  185 VIAQVLELGIIVHSVVIGISLGASQSPDAAKALFIALMFHQCFEGLGLGGCIAQGKFKCLSVTIMSTFFAITTPIGIVVGMGIANSYDESSPTALIVQGVLNAASAGILIYMSLVDLLAADFTHPKMQSNTGLQIMAHIALLLGAGLMSLLAKWA 339          
BLAST of CD858730 vs. SwissProt
Match: ZIP5_ARATH (Zinc transporter 5 OS=Arabidopsis thaliana GN=ZIP5 PE=2 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 4.992e-39
Identity = 82/155 (52.90%), Postives = 109/155 (70.32%), Query Frame = -1
Query:  100 VVSQVLELGIVSHSVIIGLSLGVSQSPCAIRPLIAALSFHQFFEGFALGGCISQAQFKASSATIMACFFALXXXXXXXXXXXIASVYNPYSPGALIAEGILDSLSAGILVYMALVDLIAADFLSKRMSCNFRLQLVSYCMLFLGAGLMSSLAIWA 564
            VV+QVLE+GI+ HSV+IG+SLG SQSP   + L AAL FHQ FEG  LGGCI+Q  F   S TIM+ FF++           I+S Y+  SP ALI +G+L++ SAGIL+YM+LVD +AADF+  +M  N RLQ++++  L +GAG+MS LA WA
Sbjct:  206 VVAQVLEVGIIVHSVVIGISLGASQSPDTAKALFAALMFHQCFEGLGLGGCIAQGNFNCMSITIMSIFFSVTTPVGIAVGMAISSSYDDSSPTALIVQGVLNAASAGILIYMSLVDFLAADFMHPKMQSNTRLQIMAHISLLVGAGVMSLLAKWA 360          
BLAST of CD858730 vs. SwissProt
Match: ZIP1_ARATH (Zinc transporter 1 OS=Arabidopsis thaliana GN=ZIP1 PE=2 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 8.515e-39
Identity = 87/160 (54.37%), Postives = 110/160 (68.75%), Query Frame = -1
Query:  100 RHVVVSQVLELGIVSHSVIIGLSLGVSQSPCAIRPLIAALSFHQFFEGFALGGCISQAQFKASSATIMACFFALXXXXXXXXXXXIAS--VYNPYSPGALIAEGILDSLSAGILVYMALVDLIAADFLSKRMSCNFRLQLVSYCMLFLGAGLMSSLAIWA 573
            R  +VSQVLE+GIV HSVIIG+SLG SQS   I+PL+AALSFHQFFEG  LGGCIS A  K+ S  +MA FF++           ++S   Y   S  A++ EG+L++ SAGIL+YM+LVDL+A DF++ R+  N  L L +Y  L LGAG MS LAIWA
Sbjct:  196 RRRIVSQVLEIGIVVHSVIIGISLGASQSIDTIKPLMAALSFHQFFEGLGLGGCISLADMKSKSTVLMATFFSVTAPLGIGIGLGMSSGLGYRKESKEAIMVEGMLNAASAGILIYMSLVDLLATDFMNPRLQSNLWLHLAAYLSLVLGAGSMSLLAIWA 355          
BLAST of CD858730 vs. SwissProt
Match: ZIP12_ARATH (Probable zinc transporter 12 OS=Arabidopsis thaliana GN=ZIP12 PE=2 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 5.519e-38
Identity = 80/158 (50.63%), Postives = 108/158 (68.35%), Query Frame = -1
Query:  100 RHVVVSQVLELGIVSHSVIIGLSLGVSQSPCAIRPLIAALSFHQFFEGFALGGCISQAQFKASSATIMACFFALXXXXXXXXXXXIASVYNPYSPGALIAEGILDSLSAGILVYMALVDLIAADFLSKRMSCNFRLQLVSYCMLFLGAGLMSSLAIWA 573
            R  +V+Q+LELGIV HSVIIG+SLG S S   I+PLIAA++FHQ FEGF LGGCIS+A+F+     +M  FFAL           +A +YN  SP AL   G L++ ++GIL+YMALVDL+A  F++++   + ++Q+     L +GAGLMS LAIWA
Sbjct:  198 RKKIVTQILELGIVVHSVIIGISLGASPSVSTIKPLIAAITFHQLFEGFGLGGCISEAKFRVKKIWVMLMFFALTAPIGIGIGIGVAEIYNENSPMALKVSGFLNATASGILIYMALVDLVAPLFMNQKTQSSMKIQVACSVSLVVGAGLMSLLAIWA 355          
BLAST of CD858730 vs. SwissProt
Match: ZIP6_ARATH (Zinc transporter 6, chloroplastic OS=Arabidopsis thaliana GN=ZIP6 PE=2 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 5.166e-36
Identity = 83/162 (51.23%), Postives = 106/162 (65.43%), Query Frame = -1
Query:  100 VVSQVLELGIVSHSVIIGLSLGVSQSPCAIRPLIAALSFHQFFEGFALGGCISQAQFKASSATIMACFFAL--XXXXXXXXXXXIASVYNPYSPGALIAEGILDSLSAGILVYMALVDLIAADFLSKRM-----SCNFRLQLVSYCMLFLGAGLMSSLAIWA 564
            +VSQVLE+GI+ HSVIIG+++G+SQ+ C IRPLIAALSFHQ FEG  LGGCI+QA FKA +   M   FA+              A+ Y+  +P ALI EG+L S S+GIL+YMALVDLIA DF   +M         RL+ + +  L LG+  MS LA+WA
Sbjct:  180 LVSQVLEIGIIFHSVIIGVTMGMSQNKCTIRPLIAALSFHQIFEGLGLGGCIAQAGFKAGTVVYMCLMFAVTTPLGIVLGMVIFAATGYDDQNPNALIMEGLLGSFSSGILIYMALVDLIALDFFHNKMLTTCGESGSRLKKLCFVALVLGSASMSLLALWA 341          
BLAST of CD858730 vs. SwissProt
Match: ZIP8_ARATH (Probable zinc transporter 8 OS=Arabidopsis thaliana GN=ZIP8 PE=2 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 5.712e-35
Identity = 78/158 (49.37%), Postives = 103/158 (65.19%), Query Frame = -1
Query:  100 RHVVVSQVLELGIVSHSVIIGLSLGVSQSPCAIRPLIAALSFHQFFEGFALGGCISQAQFKASSATIMACFFALXXXXXXXXXXXIASVYNPYSPGALIAEGILDSLSAGILVYMALVDLIAADFLSKRMSCNFRLQLVSYCMLFLGAGLMSSLAIWA 573
            R+ V++ VLELGI+ HSV+IGLSLG +   C I+ LIAAL FHQ FEG  LGGCI QA++      +MA FFA+           ++SVY   SP ALI  G+L++ SAG+L+YMALVDL+AA+F+   +  + +LQL  +    LG G MS LA WA
Sbjct:  190 RYRVIATVLELGIIVHSVVIGLSLGATNDTCTIKGLIAALCFHQMFEGMGLGGCILQAEYTNVKKFVMAFFFAVTTPSGIALGIALSSVYKDNSPTALITVGLLNACSAGLLIYMALVDLLAAEFMGSMLQRSVKLQLNCFGAALLGCGGMSVLAKWA 347          
BLAST of CD858730 vs. SwissProt
Match: ZIP10_ARATH (Probable zinc transporter 10 OS=Arabidopsis thaliana GN=ZIP10 PE=2 SV=2)

HSP 1 Score: 146.362 bits (368), Expect = 9.743e-35
Identity = 75/158 (47.47%), Postives = 106/158 (67.09%), Query Frame = -1
Query:  100 RHVVVSQVLELGIVSHSVIIGLSLGVSQSPCAIRPLIAALSFHQFFEGFALGGCISQAQFKASSATIMACFFALXXXXXXXXXXXIASVYNPYSPGALIAEGILDSLSAGILVYMALVDLIAADFLSKRMSCNFRLQLVSYCMLFLGAGLMSSLAIWA 573
            R+ +++ VLELGIV  S++IGLS+G + + C I+ L+AAL FHQ FEG  LGGCI QA++      +MA FFA+           ++  Y   SP +LI  G+L++ SAG+L+YMALVDL+AADF+ ++M  + +LQL SY  + LGAG MS +A WA
Sbjct:  207 RYRILAIVLELGIVVQSIVIGLSVGDTNNTCTIKGLVAALCFHQMFEGMGLGGCILQAEYGWVKKAVMAFFFAVTTPFGVVLGMALSKTYKENSPESLITVGLLNASSAGLLIYMALVDLLAADFMGQKMQRSIKLQLKSYAAVLLGAGGMSVMAKWA 364          
BLAST of CD858730 vs. TAIR peptide
Match: AT1G10970.1 (| Symbols: ZIP4, ATZIP4 | zinc transporter 4 precursor | chr1:3665201-3666933 REVERSE LENGTH=408)

HSP 1 Score: 252.677 bits (644), Expect = 1.025e-67
Identity = 130/158 (82.28%), Postives = 139/158 (87.97%), Query Frame = -1
Query:  100 RHVVVSQVLELGIVSHSVIIGLSLGVSQSPCAIRPLIAALSFHQFFEGFALGGCISQAQFKASSATIMACFFALXXXXXXXXXXXIASVYNPYSPGALIAEGILDSLSAGILVYMALVDLIAADFLSKRMSCNFRLQLVSYCMLFLGAGLMSSLAIWA 573
            RHVVVSQ+LELGIVSHS+IIGLSLGVSQSPC IRPLIAALSFHQFFEGFALGGCISQAQF+  SATIMACFFAL           +AS +N +SPGAL+ EGILDSLSAGILVYMALVDLIAADFLSKRMSCN RLQ+VSY MLFLGAGLMS+LAIWA
Sbjct:  251 RHVVVSQILELGIVSHSIIIGLSLGVSQSPCTIRPLIAALSFHQFFEGFALGGCISQAQFRNKSATIMACFFALTTPLGIGIGTAVASSFNSHSPGALVTEGILDSLSAGILVYMALVDLIAADFLSKRMSCNLRLQVVSYVMLFLGAGLMSALAIWA 408          
BLAST of CD858730 vs. TAIR peptide
Match: AT1G60960.1 (| Symbols: IRT3, ATIRT3 | iron regulated transporter 3 | chr1:22445410-22447060 REVERSE LENGTH=425)

HSP 1 Score: 247.669 bits (631), Expect = 3.299e-66
Identity = 128/158 (81.01%), Postives = 137/158 (86.71%), Query Frame = -1
Query:  100 RHVVVSQVLELGIVSHSVIIGLSLGVSQSPCAIRPLIAALSFHQFFEGFALGGCISQAQFKASSATIMACFFALXXXXXXXXXXXIASVYNPYSPGALIAEGILDSLSAGILVYMALVDLIAADFLSKRMSCNFRLQLVSYCMLFLGAGLMSSLAIWA 573
            RH+VVSQVLELGIVSHS+IIGLSLGVSQSPC IRPLIAALSFHQFFEGFALGGCISQAQF+  SATIMACFFAL           +AS +N +S GAL+ EGILDSLSAGILVYMALVDLIAADFLS +M CNFRLQ+VSY MLFLGAGLMSSLAIWA
Sbjct:  268 RHIVVSQVLELGIVSHSIIIGLSLGVSQSPCTIRPLIAALSFHQFFEGFALGGCISQAQFRNKSATIMACFFALTTPIGIGIGTAVASSFNSHSVGALVTEGILDSLSAGILVYMALVDLIAADFLSTKMRCNFRLQIVSYVMLFLGAGLMSSLAIWA 425          
BLAST of CD858730 vs. TAIR peptide
Match: AT4G33020.1 (| Symbols: ZIP9, ATZIP9 | ZIP metal ion transporter family | chr4:15932603-15934267 REVERSE LENGTH=344)

HSP 1 Score: 222.246 bits (565), Expect = 1.484e-58
Identity = 111/158 (70.25%), Postives = 131/158 (82.91%), Query Frame = -1
Query:  100 RHVVVSQVLELGIVSHSVIIGLSLGVSQSPCAIRPLIAALSFHQFFEGFALGGCISQAQFKASSATIMACFFALXXXXXXXXXXXIASVYNPYSPGALIAEGILDSLSAGILVYMALVDLIAADFLSKRMSCNFRLQLVSYCMLFLGAGLMSSLAIWA 573
            RHVVVSQ+LE+GIVSHS+IIG+SLGVS SPC IRPL+ ALSFHQFFEGFALGGC+++A+     + +MA FFA+           IAS YN YS  AL+AEG+LDSLSAGILVYMALVDLIAADFLSK+MS +FR+Q+VSYC LFLGAG+MS+LAIWA
Sbjct:  187 RHVVVSQILEMGIVSHSIIIGISLGVSHSPCTIRPLLLALSFHQFFEGFALGGCVAEARLTPRGSAMMAFFFAITTPIGVAVGTAIASSYNSYSVAALVAEGVLDSLSAGILVYMALVDLIAADFLSKKMSVDFRVQVVSYCFLFLGAGMMSALAIWA 344          
BLAST of CD858730 vs. TAIR peptide
Match: AT2G32270.1 (| Symbols: ZIP3 | zinc transporter 3 precursor | chr2:13704278-13706612 FORWARD LENGTH=339)

HSP 1 Score: 164.851 bits (416), Expect = 2.812e-41
Identity = 86/155 (55.48%), Postives = 110/155 (70.97%), Query Frame = -1
Query:  100 VVSQVLELGIVSHSVIIGLSLGVSQSPCAIRPLIAALSFHQFFEGFALGGCISQAQFKASSATIMACFFALXXXXXXXXXXXIASVYNPYSPGALIAEGILDSLSAGILVYMALVDLIAADFLSKRMSCNFRLQLVSYCMLFLGAGLMSSLAIWA 564
            V++QVLELGI+ HSV+IG+SLG SQSP A + L  AL FHQ FEG  LGGCI+Q +FK  S TIM+ FFA+           IA+ Y+  SP ALI +G+L++ SAGIL+YM+LVDL+AADF   +M  N  LQ++++  L LGAGLMS LA WA
Sbjct:  185 VIAQVLELGIIVHSVVIGISLGASQSPDAAKALFIALMFHQCFEGLGLGGCIAQGKFKCLSVTIMSTFFAITTPIGIVVGMGIANSYDESSPTALIVQGVLNAASAGILIYMSLVDLLAADFTHPKMQSNTGLQIMAHIALLLGAGLMSLLAKWA 339          
BLAST of CD858730 vs. TAIR peptide
Match: AT1G05300.1 (| Symbols: ZIP5 | zinc transporter 5 precursor | chr1:1545258-1547709 REVERSE LENGTH=360)

HSP 1 Score: 160.614 bits (405), Expect = 5.303e-40
Identity = 82/155 (52.90%), Postives = 109/155 (70.32%), Query Frame = -1
Query:  100 VVSQVLELGIVSHSVIIGLSLGVSQSPCAIRPLIAALSFHQFFEGFALGGCISQAQFKASSATIMACFFALXXXXXXXXXXXIASVYNPYSPGALIAEGILDSLSAGILVYMALVDLIAADFLSKRMSCNFRLQLVSYCMLFLGAGLMSSLAIWA 564
            VV+QVLE+GI+ HSV+IG+SLG SQSP   + L AAL FHQ FEG  LGGCI+Q  F   S TIM+ FF++           I+S Y+  SP ALI +G+L++ SAGIL+YM+LVD +AADF+  +M  N RLQ++++  L +GAG+MS LA WA
Sbjct:  206 VVAQVLEVGIIVHSVVIGISLGASQSPDTAKALFAALMFHQCFEGLGLGGCIAQGNFNCMSITIMSIFFSVTTPVGIAVGMAISSSYDDSSPTALIVQGVLNAASAGILIYMSLVDFLAADFMHPKMQSNTRLQIMAHISLLVGAGVMSLLAKWA 360          
BLAST of CD858730 vs. TAIR peptide
Match: AT3G12750.1 (| Symbols: ZIP1 | zinc transporter 1 precursor | chr3:4051950-4053156 REVERSE LENGTH=355)

HSP 1 Score: 159.844 bits (403), Expect = 9.046e-40
Identity = 87/160 (54.37%), Postives = 110/160 (68.75%), Query Frame = -1
Query:  100 RHVVVSQVLELGIVSHSVIIGLSLGVSQSPCAIRPLIAALSFHQFFEGFALGGCISQAQFKASSATIMACFFALXXXXXXXXXXXIAS--VYNPYSPGALIAEGILDSLSAGILVYMALVDLIAADFLSKRMSCNFRLQLVSYCMLFLGAGLMSSLAIWA 573
            R  +VSQVLE+GIV HSVIIG+SLG SQS   I+PL+AALSFHQFFEG  LGGCIS A  K+ S  +MA FF++           ++S   Y   S  A++ EG+L++ SAGIL+YM+LVDL+A DF++ R+  N  L L +Y  L LGAG MS LAIWA
Sbjct:  196 RRRIVSQVLEIGIVVHSVIIGISLGASQSIDTIKPLMAALSFHQFFEGLGLGGCISLADMKSKSTVLMATFFSVTAPLGIGIGLGMSSGLGYRKESKEAIMVEGMLNAASAGILIYMSLVDLLATDFMNPRLQSNLWLHLAAYLSLVLGAGSMSLLAIWA 355          
BLAST of CD858730 vs. TAIR peptide
Match: AT5G62160.1 (| Symbols: AtZIP12, ZIP12 | zinc transporter 12 precursor | chr5:24960107-24961263 FORWARD LENGTH=355)

HSP 1 Score: 157.147 bits (396), Expect = 5.863e-39
Identity = 80/158 (50.63%), Postives = 108/158 (68.35%), Query Frame = -1
Query:  100 RHVVVSQVLELGIVSHSVIIGLSLGVSQSPCAIRPLIAALSFHQFFEGFALGGCISQAQFKASSATIMACFFALXXXXXXXXXXXIASVYNPYSPGALIAEGILDSLSAGILVYMALVDLIAADFLSKRMSCNFRLQLVSYCMLFLGAGLMSSLAIWA 573
            R  +V+Q+LELGIV HSVIIG+SLG S S   I+PLIAA++FHQ FEGF LGGCIS+A+F+     +M  FFAL           +A +YN  SP AL   G L++ ++GIL+YMALVDL+A  F++++   + ++Q+     L +GAGLMS LAIWA
Sbjct:  198 RKKIVTQILELGIVVHSVIIGISLGASPSVSTIKPLIAAITFHQLFEGFGLGGCISEAKFRVKKIWVMLMFFALTAPIGIGIGIGVAEIYNENSPMALKVSGFLNATASGILIYMALVDLVAPLFMNQKTQSSMKIQVACSVSLVVGAGLMSLLAIWA 355          
BLAST of CD858730 vs. TAIR peptide
Match: AT2G30080.1 (| Symbols: ZIP6, ATZIP6 | ZIP metal ion transporter family | chr2:12838730-12840112 REVERSE LENGTH=341)

HSP 1 Score: 150.599 bits (379), Expect = 5.488e-37
Identity = 83/162 (51.23%), Postives = 106/162 (65.43%), Query Frame = -1
Query:  100 VVSQVLELGIVSHSVIIGLSLGVSQSPCAIRPLIAALSFHQFFEGFALGGCISQAQFKASSATIMACFFAL--XXXXXXXXXXXIASVYNPYSPGALIAEGILDSLSAGILVYMALVDLIAADFLSKRM-----SCNFRLQLVSYCMLFLGAGLMSSLAIWA 564
            +VSQVLE+GI+ HSVIIG+++G+SQ+ C IRPLIAALSFHQ FEG  LGGCI+QA FKA +   M   FA+              A+ Y+  +P ALI EG+L S S+GIL+YMALVDLIA DF   +M         RL+ + +  L LG+  MS LA+WA
Sbjct:  180 LVSQVLEIGIIFHSVIIGVTMGMSQNKCTIRPLIAALSFHQIFEGLGLGGCIAQAGFKAGTVVYMCLMFAVTTPLGIVLGMVIFAATGYDDQNPNALIMEGLLGSFSSGILIYMALVDLIALDFFHNKMLTTCGESGSRLKKLCFVALVLGSASMSLLALWA 341          
BLAST of CD858730 vs. TAIR peptide
Match: AT1G31260.1 (| Symbols: ZIP10 | zinc transporter 10 precursor | chr1:11175559-11177362 REVERSE LENGTH=364)

HSP 1 Score: 146.362 bits (368), Expect = 1.035e-35
Identity = 75/158 (47.47%), Postives = 106/158 (67.09%), Query Frame = -1
Query:  100 RHVVVSQVLELGIVSHSVIIGLSLGVSQSPCAIRPLIAALSFHQFFEGFALGGCISQAQFKASSATIMACFFALXXXXXXXXXXXIASVYNPYSPGALIAEGILDSLSAGILVYMALVDLIAADFLSKRMSCNFRLQLVSYCMLFLGAGLMSSLAIWA 573
            R+ +++ VLELGIV  S++IGLS+G + + C I+ L+AAL FHQ FEG  LGGCI QA++      +MA FFA+           ++  Y   SP +LI  G+L++ SAG+L+YMALVDL+AADF+ ++M  + +LQL SY  + LGAG MS +A WA
Sbjct:  207 RYRILAIVLELGIVVQSIVIGLSVGDTNNTCTIKGLVAALCFHQMFEGMGLGGCILQAEYGWVKKAVMAFFFAVTTPFGVVLGMALSKTYKENSPESLITVGLLNASSAGLLIYMALVDLLAADFMGQKMQRSIKLQLKSYAAVLLGAGGMSVMAKWA 364          
BLAST of CD858730 vs. TAIR peptide
Match: AT4G19690.2 (| Symbols: IRT1 | iron-regulated transporter 1 | chr4:10707487-10708723 FORWARD LENGTH=347)

HSP 1 Score: 144.436 bits (363), Expect = 3.933e-35
Identity = 74/158 (46.84%), Postives = 102/158 (64.56%), Query Frame = -1
Query:  100 RHVVVSQVLELGIVSHSVIIGLSLGVSQSPCAIRPLIAALSFHQFFEGFALGGCISQAQFKASSATIMACFFALXXXXXXXXXXXIASVYNPYSPGALIAEGILDSLSAGILVYMALVDLIAADFLSKRMSCNFRLQLVSYCMLFLGAGLMSSLAIWA 573
            R+ V++ VLELGI+ HSV+IGLSLG +   C I+ LIAAL FHQ FEG  LGGCI QA++      +MA FFA+           +++VY   SP ALI  G+L++ SAG+L+YMALVDL+AA+F+  ++  + ++Q        LG G MS +A WA
Sbjct:  190 RYRVIAMVLELGIIVHSVVIGLSLGATSDTCTIKGLIAALCFHQMFEGMGLGGCILQAEYTNMKKFVMAFFFAVTTPFGIALGIALSTVYQDNSPKALITVGLLNACSAGLLIYMALVDLLAAEFMGPKLQGSIKMQFKCLIAALLGCGGMSIIAKWA 347          
The following BLAST results are available for this feature:
BLAST of CD858730 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
B9IKA5_POPTR7.091e-6784.18ZIP transporter OS=Populus trichocarpa GN=POPTRDRA... [more]
B9RRS3_RICCO2.063e-6683.54Zinc/iron transporter, putative OS=Ricinus communi... [more]
D7KLL3_ARALY2.281e-6581.65Putative uncharacterized protein OS=Arabidopsis ly... [more]
Q6VM17_MEDTR2.979e-6581.01Metal transport protein OS=Medicago truncatula GN=... [more]
Q5CCL8_THLJA2.979e-6582.28ZIP family metal transporter OS=Thlaspi japonicum ... [more]
Q9FPW7_THLCA8.668e-6582.17Putative Zn transporter ZNT4 OS=Thlaspi caerulesce... [more]
Q93XE7_THLCA8.668e-6582.17ZIP-like zinc transporter OS=Thlaspi caerulescens ... [more]
D7KW68_ARALY8.668e-6582.28Putative uncharacterized protein OS=Arabidopsis ly... [more]
Q9M7J1_THLCA1.132e-6481.65Zn and Cd transporter ZNT1 OS=Thlaspi caerulescens... [more]
Q93XE8_THLCA1.132e-6481.65ZIP-like zinc transporter OS=Thlaspi caerulescens ... [more]
back to top
BLAST of CD858730 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Swissprot)
Total hits: 10
Match NameE-valueIdentityDescription
ZIP4_ARATH9.653e-6782.28Zinc transporter 4, chloroplastic OS=Arabidopsis t... [more]
IRT3_ARATH3.105e-6581.01Fe(2+) transport protein 3, chloroplastic OS=Arabi... [more]
ZIP9_ARATH1.397e-5770.25Zinc transporter 9 OS=Arabidopsis thaliana GN=ZIP9... [more]
ZIP3_ARATH2.647e-4055.48Zinc transporter 3 OS=Arabidopsis thaliana GN=ZIP3... [more]
ZIP5_ARATH4.992e-3952.90Zinc transporter 5 OS=Arabidopsis thaliana GN=ZIP5... [more]
ZIP1_ARATH8.515e-3954.38Zinc transporter 1 OS=Arabidopsis thaliana GN=ZIP1... [more]
ZIP12_ARATH5.519e-3850.63Probable zinc transporter 12 OS=Arabidopsis thalia... [more]
ZIP6_ARATH5.166e-3651.23Zinc transporter 6, chloroplastic OS=Arabidopsis t... [more]
ZIP8_ARATH5.712e-3549.37Probable zinc transporter 8 OS=Arabidopsis thalian... [more]
ZIP10_ARATH9.743e-3547.47Probable zinc transporter 10 OS=Arabidopsis thalia... [more]
back to top
BLAST of CD858730 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide)
Total hits: 10
Match NameE-valueIdentityDescription
AT1G10970.11.025e-6782.28| Symbols: ZIP4, ATZIP4 | zinc transporter 4 precu... [more]
AT1G60960.13.299e-6681.01| Symbols: IRT3, ATIRT3 | iron regulated transport... [more]
AT4G33020.11.484e-5870.25| Symbols: ZIP9, ATZIP9 | ZIP metal ion transporte... [more]
AT2G32270.12.812e-4155.48| Symbols: ZIP3 | zinc transporter 3 precursor | c... [more]
AT1G05300.15.303e-4052.90| Symbols: ZIP5 | zinc transporter 5 precursor | c... [more]
AT3G12750.19.046e-4054.38| Symbols: ZIP1 | zinc transporter 1 precursor | c... [more]
AT5G62160.15.863e-3950.63| Symbols: AtZIP12, ZIP12 | zinc transporter 12 pr... [more]
AT2G30080.15.488e-3751.23| Symbols: ZIP6, ATZIP6 | ZIP metal ion transporte... [more]
AT1G31260.11.035e-3547.47| Symbols: ZIP10 | zinc transporter 10 precursor |... [more]
AT4G19690.23.933e-3546.84| Symbols: IRT1 | iron-regulated transporter 1 | c... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003689Zinc/iron permeasePFAMPF02535Zipcoord: 4..155
score: 4.3
NoneNo IPR availablePANTHERPTHR11040ZINC/IRON TRANSPORTERcoord: 1..158
score: 5
NoneNo IPR availablePANTHERPTHR11040:SF1ZINC/IRON TRANSPORTER, PLANT AND YEASTcoord: 1..158
score: 5
NoneNo IPR availableSEGsegsegcoord: 75..86
score

Properties
Property NameValue
Singlet in analysisPisum sativum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>CD858730 ID=CD858730|Name=CD858730|organism=Pisum sativum|type=EST|length=573bp
GCGAACCAATATCTATTAATGTCTCACCTCTTCCCAATAAATTGAGCACA
TCTATCTATAATGAAACAGAGTGTCAATTACTCCAAGCAAAAATGTTCAT
GCCCATATTGCTAATGAAGACATTAACCCAGCTCCAAGGAAAAGCATACA
ATAAGATACTAACTGCAGCCTAAAGTTACAACTCATTCTTTTGCTAAGAA
AATCAGCCGCTATCAAATCTACTAAAGCCATATAAACTAAAATCCCTGCT
GACAATGAGTCCAATATACCTTCAGCAATGAGTGCACCAGGACTGTAAGG
GTTATAAACTGAAGCAATGCCTGTTCCAATGCCAACACCAATAGGTGTAG
TCAGTGCAAAAAAACAAGCCATTATTGTTGCTGATGAGGCCTTGAATTGA
GCCTGGGAGATGCACCCTCCAAGTGCAAACCCTTCAAAAAATTGATGGAA
AGATAATGCTGCAATTAGAGGCCTTATAGCACAAGGGCTTTGTGAAACAC
CCAGAGACAATCCAATTATCACTGAATGTGATACTATCCCAAGCTCCAAA
ACCTGAGAAACGACGACGTGTCG
back to top
Annotated Terms
The following terms have been associated with this EST:
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane
Vocabulary: Biological Process
TermDefinition
GO:0030001metal ion transport
GO:0055085transmembrane transport
Vocabulary: Molecular Function
TermDefinition
GO:0046873metal ion transmembrane transporter activity
Vocabulary: INTERPRO
TermDefinition
IPR003689ZIP