GH720808

EST Overview
NameGH720808
Unique NameGH720808
TypeEST
OrganismPisum sativum (pea)
Sequence length622
Libraries
Library NameType
LIBEST_024273 BACNIcdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Pisum sativum unigene v1Pisum sativum unigene v1EST
Homology
BLAST of GH720808 vs. TrEMBL
Match: Q712V4_PEA (Histone H3 (Fragment) OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 7.070e-53
Identity = 108/108 (100.00%), Postives = 108/108 (100.00%), Query Frame = -2
Query:  214 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 537
            QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL
Sbjct:    7 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 114          
BLAST of GH720808 vs. TrEMBL
Match: D5AAJ9_PICSI (Histone H3 OS=Picea sitchensis PE=2 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 7.070e-53
Identity = 108/108 (100.00%), Postives = 108/108 (100.00%), Query Frame = -2
Query:  214 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 537
            QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL
Sbjct:   20 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 127          
BLAST of GH720808 vs. TrEMBL
Match: D2JYR8_WOLAR (Histone H3 OS=Wolffia arrhiza PE=2 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 7.070e-53
Identity = 108/108 (100.00%), Postives = 108/108 (100.00%), Query Frame = -2
Query:  214 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 537
            QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL
Sbjct:   20 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 127          
BLAST of GH720808 vs. TrEMBL
Match: C6SZA4_SOYBN (Histone H3 OS=Glycine max PE=2 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 7.070e-53
Identity = 108/108 (100.00%), Postives = 108/108 (100.00%), Query Frame = -2
Query:  214 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 537
            QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL
Sbjct:   20 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 127          
BLAST of GH720808 vs. TrEMBL
Match: B7FN22_MEDTR (Histone H3 OS=Medicago truncatula PE=2 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 7.070e-53
Identity = 108/108 (100.00%), Postives = 108/108 (100.00%), Query Frame = -2
Query:  214 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 537
            QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL
Sbjct:   20 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 127          
BLAST of GH720808 vs. TrEMBL
Match: B6SIV8_MAIZE (Histone H3 OS=Zea mays PE=2 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 7.070e-53
Identity = 108/108 (100.00%), Postives = 108/108 (100.00%), Query Frame = -2
Query:  214 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 537
            QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL
Sbjct:   20 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 127          
BLAST of GH720808 vs. TrEMBL
Match: Q71CZ4_OROCE (Histone H3 OS=Orobanche cernua var. cumana PE=2 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 1.575e-52
Identity = 107/108 (99.07%), Postives = 108/108 (100.00%), Query Frame = -2
Query:  214 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 537
            QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL
Sbjct:   20 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 127          
BLAST of GH720808 vs. TrEMBL
Match: Q53NE3_ORYSJ (Histone H3 OS=Oryza sativa subsp. japonica GN=LOC_Os11g05730 PE=3 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 1.575e-52
Identity = 107/108 (99.07%), Postives = 108/108 (100.00%), Query Frame = -2
Query:  214 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 537
            QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL
Sbjct:   20 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 127          
BLAST of GH720808 vs. TrEMBL
Match: Q4AC00_BRACM (Histone H3 OS=Brassica campestris GN=117M18_20 PE=3 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 1.575e-52
Identity = 107/108 (99.07%), Postives = 108/108 (100.00%), Query Frame = -2
Query:  214 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 537
            QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL
Sbjct:   20 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 127          
BLAST of GH720808 vs. TrEMBL
Match: Q0WRA9_ARATH (Histone H3 OS=Arabidopsis thaliana GN=At1g09200 PE=2 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 1.575e-52
Identity = 107/108 (99.07%), Postives = 108/108 (100.00%), Query Frame = -2
Query:  214 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 537
            QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL
Sbjct:   20 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 127          
BLAST of GH720808 vs. SwissProt
Match: H32_WHEAT (Histone H3.2 OS=Triticum aestivum PE=1 SV=2)

HSP 1 Score: 210.69 bits (535), Expect = 4.974e-54
Identity = 108/108 (100.00%), Postives = 108/108 (100.00%), Query Frame = -2
Query:  214 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 537
            QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL
Sbjct:   20 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 127          
BLAST of GH720808 vs. SwissProt
Match: H32_PEA (Histone H3.2 OS=Pisum sativum PE=1 SV=2)

HSP 1 Score: 210.69 bits (535), Expect = 4.974e-54
Identity = 108/108 (100.00%), Postives = 108/108 (100.00%), Query Frame = -2
Query:  214 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 537
            QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL
Sbjct:   20 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 127          
BLAST of GH720808 vs. SwissProt
Match: H32_ONOVI (Histone H3.2 OS=Onobrychis viciifolia PE=2 SV=2)

HSP 1 Score: 210.69 bits (535), Expect = 4.974e-54
Identity = 108/108 (100.00%), Postives = 108/108 (100.00%), Query Frame = -2
Query:  214 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 537
            QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL
Sbjct:   20 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 127          
BLAST of GH720808 vs. SwissProt
Match: H32_MEDSA (Histone H3.2 OS=Medicago sativa GN=H3-1.1 PE=1 SV=2)

HSP 1 Score: 210.69 bits (535), Expect = 4.974e-54
Identity = 108/108 (100.00%), Postives = 108/108 (100.00%), Query Frame = -2
Query:  214 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 537
            QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL
Sbjct:   20 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 127          
BLAST of GH720808 vs. SwissProt
Match: H32_TOBAC (Histone H3.2 OS=Nicotiana tabacum GN=B34 PE=1 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 1.108e-53
Identity = 107/108 (99.07%), Postives = 108/108 (100.00%), Query Frame = -2
Query:  214 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 537
            QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL
Sbjct:   20 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 127          
BLAST of GH720808 vs. SwissProt
Match: H32_PETCR (Histone H3.2 OS=Petroselinum crispum GN=H3-7 PE=3 SV=2)

HSP 1 Score: 209.534 bits (532), Expect = 1.108e-53
Identity = 107/108 (99.07%), Postives = 108/108 (100.00%), Query Frame = -2
Query:  214 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 537
            QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL
Sbjct:   20 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 127          
BLAST of GH720808 vs. SwissProt
Match: H32_ORYSJ (Histone H3.2 OS=Oryza sativa subsp. japonica GN=Os01g0866200 PE=2 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 1.108e-53
Identity = 107/108 (99.07%), Postives = 108/108 (100.00%), Query Frame = -2
Query:  214 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 537
            QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL
Sbjct:   20 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 127          
BLAST of GH720808 vs. SwissProt
Match: H32_ORYSI (Histone H3.2 OS=Oryza sativa subsp. indica GN=OsI_019426 PE=2 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 1.108e-53
Identity = 107/108 (99.07%), Postives = 108/108 (100.00%), Query Frame = -2
Query:  214 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 537
            QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL
Sbjct:   20 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 127          
BLAST of GH720808 vs. SwissProt
Match: H32_MAIZE (Histone H3.2 OS=Zea mays GN=H3C2 PE=1 SV=2)

HSP 1 Score: 209.534 bits (532), Expect = 1.108e-53
Identity = 107/108 (99.07%), Postives = 108/108 (100.00%), Query Frame = -2
Query:  214 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 537
            QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL
Sbjct:   20 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 127          
BLAST of GH720808 vs. SwissProt
Match: H32_EUPES (Histone H3.2 OS=Euphorbia esula GN=H3 PE=2 SV=3)

HSP 1 Score: 209.534 bits (532), Expect = 1.108e-53
Identity = 107/108 (99.07%), Postives = 108/108 (100.00%), Query Frame = -2
Query:  214 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 537
            QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL
Sbjct:   20 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 127          
BLAST of GH720808 vs. TAIR peptide
Match: AT5G65360.1 (| Symbols: | Histone superfamily protein | chr5:26120099-26120509 REVERSE LENGTH=136)

HSP 1 Score: 209.534 bits (532), Expect = 1.147e-54
Identity = 107/108 (99.07%), Postives = 108/108 (100.00%), Query Frame = -2
Query:  214 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 537
            QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL
Sbjct:   20 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 127          
BLAST of GH720808 vs. TAIR peptide
Match: AT5G10400.1 (| Symbols: | Histone superfamily protein | chr5:3270478-3270888 REVERSE LENGTH=136)

HSP 1 Score: 209.534 bits (532), Expect = 1.147e-54
Identity = 107/108 (99.07%), Postives = 108/108 (100.00%), Query Frame = -2
Query:  214 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 537
            QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL
Sbjct:   20 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 127          
BLAST of GH720808 vs. TAIR peptide
Match: AT5G10390.1 (| Symbols: | Histone superfamily protein | chr5:3269065-3269475 REVERSE LENGTH=136)

HSP 1 Score: 209.534 bits (532), Expect = 1.147e-54
Identity = 107/108 (99.07%), Postives = 108/108 (100.00%), Query Frame = -2
Query:  214 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 537
            QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL
Sbjct:   20 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 127          
BLAST of GH720808 vs. TAIR peptide
Match: AT3G27360.1 (| Symbols: | Histone superfamily protein | chr3:10129459-10129869 REVERSE LENGTH=136)

HSP 1 Score: 209.534 bits (532), Expect = 1.147e-54
Identity = 107/108 (99.07%), Postives = 108/108 (100.00%), Query Frame = -2
Query:  214 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 537
            QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL
Sbjct:   20 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 127          
BLAST of GH720808 vs. TAIR peptide
Match: AT1G09200.1 (| Symbols: | Histone superfamily protein | chr1:2971722-2972132 REVERSE LENGTH=136)

HSP 1 Score: 209.534 bits (532), Expect = 1.147e-54
Identity = 107/108 (99.07%), Postives = 108/108 (100.00%), Query Frame = -2
Query:  214 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 537
            QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL
Sbjct:   20 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 127          
BLAST of GH720808 vs. TAIR peptide
Match: AT5G10980.1 (| Symbols: | Histone superfamily protein | chr5:3472591-3473349 REVERSE LENGTH=136)

HSP 1 Score: 203.756 bits (517), Expect = 6.296e-53
Identity = 104/108 (96.30%), Postives = 105/108 (97.22%), Query Frame = -2
Query:  214 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 537
            QLATKAARKSAP TGGVKKPHR+RPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL
Sbjct:   20 QLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 127          
BLAST of GH720808 vs. TAIR peptide
Match: AT4G40030.3 (| Symbols: | Histone superfamily protein | chr4:18555840-18556417 REVERSE LENGTH=136)

HSP 1 Score: 203.756 bits (517), Expect = 6.296e-53
Identity = 104/108 (96.30%), Postives = 105/108 (97.22%), Query Frame = -2
Query:  214 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 537
            QLATKAARKSAP TGGVKKPHR+RPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL
Sbjct:   20 QLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 127          
BLAST of GH720808 vs. TAIR peptide
Match: AT4G40030.2 (| Symbols: | Histone superfamily protein | chr4:18555840-18556827 REVERSE LENGTH=164)

HSP 1 Score: 203.756 bits (517), Expect = 6.296e-53
Identity = 104/108 (96.30%), Postives = 105/108 (97.22%), Query Frame = -2
Query:  214 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 537
            QLATKAARKSAP TGGVKKPHR+RPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL
Sbjct:   48 QLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 155          
BLAST of GH720808 vs. TAIR peptide
Match: AT4G40040.2 (| Symbols: | Histone superfamily protein | chr4:18557539-18558236 REVERSE LENGTH=136)

HSP 1 Score: 203.756 bits (517), Expect = 6.296e-53
Identity = 104/108 (96.30%), Postives = 105/108 (97.22%), Query Frame = -2
Query:  214 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 537
            QLATKAARKSAP TGGVKKPHR+RPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL
Sbjct:   20 QLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 127          
BLAST of GH720808 vs. TAIR peptide
Match: AT4G40040.1 (| Symbols: | Histone superfamily protein | chr4:18557539-18558236 REVERSE LENGTH=136)

HSP 1 Score: 203.756 bits (517), Expect = 6.296e-53
Identity = 104/108 (96.30%), Postives = 105/108 (97.22%), Query Frame = -2
Query:  214 QLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 537
            QLATKAARKSAP TGGVKKPHR+RPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL
Sbjct:   20 QLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 127          
The following BLAST results are available for this feature:
BLAST of GH720808 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
Q712V4_PEA7.070e-53100.00Histone H3 (Fragment) OS=Pisum sativum PE=2 SV=1[more]
D5AAJ9_PICSI7.070e-53100.00Histone H3 OS=Picea sitchensis PE=2 SV=1[more]
D2JYR8_WOLAR7.070e-53100.00Histone H3 OS=Wolffia arrhiza PE=2 SV=1[more]
C6SZA4_SOYBN7.070e-53100.00Histone H3 OS=Glycine max PE=2 SV=1[more]
B7FN22_MEDTR7.070e-53100.00Histone H3 OS=Medicago truncatula PE=2 SV=1[more]
B6SIV8_MAIZE7.070e-53100.00Histone H3 OS=Zea mays PE=2 SV=1[more]
Q71CZ4_OROCE1.575e-5299.07Histone H3 OS=Orobanche cernua var. cumana PE=2 SV... [more]
Q53NE3_ORYSJ1.575e-5299.07Histone H3 OS=Oryza sativa subsp. japonica GN=LOC_... [more]
Q4AC00_BRACM1.575e-5299.07Histone H3 OS=Brassica campestris GN=117M18_20 PE=... [more]
Q0WRA9_ARATH1.575e-5299.07Histone H3 OS=Arabidopsis thaliana GN=At1g09200 PE... [more]
back to top
BLAST of GH720808 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Swissprot)
Total hits: 10
Match NameE-valueIdentityDescription
H32_WHEAT4.974e-54100.00Histone H3.2 OS=Triticum aestivum PE=1 SV=2[more]
H32_PEA4.974e-54100.00Histone H3.2 OS=Pisum sativum PE=1 SV=2[more]
H32_ONOVI4.974e-54100.00Histone H3.2 OS=Onobrychis viciifolia PE=2 SV=2[more]
H32_MEDSA4.974e-54100.00Histone H3.2 OS=Medicago sativa GN=H3-1.1 PE=1 SV=... [more]
H32_TOBAC1.108e-5399.07Histone H3.2 OS=Nicotiana tabacum GN=B34 PE=1 SV=1[more]
H32_PETCR1.108e-5399.07Histone H3.2 OS=Petroselinum crispum GN=H3-7 PE=3 ... [more]
H32_ORYSJ1.108e-5399.07Histone H3.2 OS=Oryza sativa subsp. japonica GN=Os... [more]
H32_ORYSI1.108e-5399.07Histone H3.2 OS=Oryza sativa subsp. indica GN=OsI_... [more]
H32_MAIZE1.108e-5399.07Histone H3.2 OS=Zea mays GN=H3C2 PE=1 SV=2[more]
H32_EUPES1.108e-5399.07Histone H3.2 OS=Euphorbia esula GN=H3 PE=2 SV=3[more]
back to top
BLAST of GH720808 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide)
Total hits: 10
Match NameE-valueIdentityDescription
AT5G65360.11.147e-5499.07| Symbols: | Histone superfamily protein | chr5:2... [more]
AT5G10400.11.147e-5499.07| Symbols: | Histone superfamily protein | chr5:3... [more]
AT5G10390.11.147e-5499.07| Symbols: | Histone superfamily protein | chr5:3... [more]
AT3G27360.11.147e-5499.07| Symbols: | Histone superfamily protein | chr3:1... [more]
AT1G09200.11.147e-5499.07| Symbols: | Histone superfamily protein | chr1:2... [more]
AT5G10980.16.296e-5396.30| Symbols: | Histone superfamily protein | chr5:3... [more]
AT4G40030.36.296e-5396.30| Symbols: | Histone superfamily protein | chr4:1... [more]
AT4G40030.26.296e-5396.30| Symbols: | Histone superfamily protein | chr4:1... [more]
AT4G40040.26.296e-5396.30| Symbols: | Histone superfamily protein | chr4:1... [more]
AT4G40040.16.296e-5396.30| Symbols: | Histone superfamily protein | chr4:1... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSEGsegsegcoord: 11..27
score
NoneNo IPR availableSEGsegsegcoord: 36..47
score: NAcoord: 51..70
score
NoneNo IPR availableGENE3D3.40.50.300no descriptioncoord: 5..51
score: 2.5
NoneNo IPR availablePANTHERPTHR11711:SF30ADP-RIBOSYLATION FACTOR, ARFcoord: 8..50
score: 1.3
NoneNo IPR availableSUPERFAMILY52540P-loop containing nucleoside triphosphate hydrolasescoord: 6..56
score: 3.8
NoneNo IPR availableSEGsegsegcoord: 37..48
score
NoneNo IPR availableSEGsegsegcoord: 34..45
score
NoneNo IPR availableSEGsegsegcoord: 44..55
score
IPR006689ARF/SAR superfamilyPANTHERPTHR11711ADP RIBOSYLATION FACTOR-RELATEDcoord: 8..50
score: 1.3
IPR006689ARF/SAR superfamilyPFAMPF00025Arfcoord: 6..53
score: 1.8
IPR000164Histone H3PRINTSPR00622HISTONEH3coord: 5..19
score: 1.2e-72coord: 22..43
score: 1.2e-72coord: 46..63
score: 1.2e-72coord: 68..86
score: 1.2e-72coord: 86..102
score: 1.2e-72coord: 102..123
score: 1.2
IPR000164Histone H3PANTHERPTHR11426HISTONE H3coord: 6..124
score: 3.4e
IPR000164Histone H3SMARTSM00428no descriptioncoord: 22..124
score: 2.3
IPR000164Histone H3PROSITEPS00959HISTONE_H3_2coord: 55..63
score
IPR007125Histone corePFAMPF00125Histonecoord: 46..120
score: 1.9
IPR009072Histone-foldGENE3D1.10.20.10no descriptioncoord: 3..124
score: 6.9
IPR009072Histone-foldSUPERFAMILY47113Histone-foldcoord: 1..124
score: 3.1

Properties
Property NameValue
Singlet in analysisPisum sativum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>GH720808 ID=GH720808|Name=GH720808|organism=Pisum sativum|type=EST|length=622bp
TAGCGTGGTCGCGGCCGAGGTACAGAACATCAGCTTCACCGTGTGGGATG
TCGGGGGTCAGGACAAGATCCGCCCATTGTGGAGGCACTACTTCCAGAAC
ACTCAGGGTCTTATTTTTGTGGTTGATAGCAATGATAGAGATCGAGTGCG
TCATCTACAGAATATGATTCCCTTCAATCAAATCTAAGCCCTCTCTCCTC
TGATTCTACGAGCAAGTTGAATATCCTTAGGCATAATGGTAACTCTCTTA
GCGTGAATTGCACAAAGGTTAGTATCTTCAAACAAACCAACTAGATATGC
TTCAGCAGCTTCTTGAAGTGCAGAAACAGCACTGCTTTGGAATCGGAGAT
CTGTTTTGAAATCTTGAGCGATTTCTCTGACTAATCTTTGGAATGGAAGC
TTCCTGATGAGAAGCTCTGTGCTCTTCTGATACTTCCTGATCTCTCTCAA
AGCAACTGTTCCTGGACGGAATCTGTGTGGCTTCTTCACTCCTCCGGTCG
CCGGAGCAGATTTACGAGCGGCTTTTGTTGCCAACTGTTTCCTTCTTCTC
TCTCTCTCTCAATTTTATTTTTCTCGCTGTTTTCGTTCCGATCGAAATGG
CTCGTACCTGCCCGGGCGGCCG
back to top
Annotated Terms
The following terms have been associated with this EST:
Vocabulary: Molecular Function
TermDefinition
GO:0005525GTP binding
GO:0003677DNA binding
Vocabulary: Cellular Component
TermDefinition
GO:0000786nucleosome
Vocabulary: Biological Process
TermDefinition
GO:0006334nucleosome assembly
Vocabulary: INTERPRO
TermDefinition
IPR006689Small_GTPase_ARF/SAR
IPR000164Histone_H3/CENP-A
IPR007125Histone_H2A/H2B/H3
IPR009072Histone-fold