FG534288

EST Overview
NameFG534288
Unique NameFG534288
TypeEST
OrganismPisum sativum (pea)
Sequence length581
Libraries
Library NameType
LIBEST_023216 MeriT Pisum sativum Shoot apical meristem ESTscdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Pisum sativum unigene v1Pisum sativum unigene v1EST
Homology
BLAST of FG534288 vs. TrEMBL
Match: C6TGZ5_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 3.675e-26
Identity = 58/78 (74.36%), Postives = 68/78 (87.18%), Query Frame = 1
Query:    7 DENTKAKGVQGVIEIENPNLVKPKNIKARDIDIGKTSELSXXXXXXIEKQRAHERYMKLQEQGKTEQSRKDLDRLALI 240
            +E +K KG QGVIEIENPNLVKPK +KARD+D+GKT+ELS      IEKQRAHERYM+LQEQGKTEQ++KDL+RLALI
Sbjct:   59 EETSKKKGTQGVIEIENPNLVKPKTLKARDVDVGKTTELSRREREEIEKQRAHERYMRLQEQGKTEQAKKDLERLALI 136          
BLAST of FG534288 vs. TrEMBL
Match: B4FS53_MAIZE (Heat-and acid-stable phosphoprotein OS=Zea mays PE=2 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 3.111e-25
Identity = 56/79 (70.89%), Postives = 68/79 (86.08%), Query Frame = 1
Query:    4 ADENTKAKGVQGVIEIENPNLVKPKNIKARDIDIGKTSELSXXXXXXIEKQRAHERYMKLQEQGKTEQSRKDLDRLALI 240
            +DE TK KG +G+I+IENPNLVK KNIKA+++D GKT+ELS      +EKQ+AHERYMKLQEQGKTEQ+RKDL+RLALI
Sbjct:   58 SDEKTKHKGTEGIIQIENPNLVKAKNIKAKEVDFGKTTELSRREREELEKQKAHERYMKLQEQGKTEQARKDLERLALI 136          
BLAST of FG534288 vs. TrEMBL
Match: B9S940_RICCO (28 kDa heat-and acid-stable phosphoprotein, putative OS=Ricinus communis GN=RCOM_1012220 PE=4 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 4.063e-25
Identity = 56/78 (71.79%), Postives = 67/78 (85.90%), Query Frame = 1
Query:    7 DENTKAKGVQGVIEIENPNLVKPKNIKARDIDIGKTSELSXXXXXXIEKQRAHERYMKLQEQGKTEQSRKDLDRLALI 240
            +++ K KG QG+I+IENPNL KPKN+KARDIDIGKT+ELS      +EKQRAHERYM+LQEQGKTEQ+RKDL+RL LI
Sbjct:   60 EQDQKRKGTQGLIQIENPNLAKPKNLKARDIDIGKTTELSRREREELEKQRAHERYMRLQEQGKTEQARKDLERLTLI 137          
BLAST of FG534288 vs. TrEMBL
Match: A9PBP5_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_586068 PE=2 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 9.052e-25
Identity = 56/78 (71.79%), Postives = 66/78 (84.62%), Query Frame = 1
Query:    7 DENTKAKGVQGVIEIENPNLVKPKNIKARDIDIGKTSELSXXXXXXIEKQRAHERYMKLQEQGKTEQSRKDLDRLALI 240
            D + K KG QG+IEIENPNLVK KN+KARD+D GKT+ELS      +EKQRAHERYM+LQEQGKTEQ+RKDL+RL+LI
Sbjct:   57 DPDQKRKGTQGIIEIENPNLVKAKNLKARDVDTGKTTELSRREREELEKQRAHERYMRLQEQGKTEQARKDLERLSLI 134          
BLAST of FG534288 vs. TrEMBL
Match: C5XK58_SORBI (Putative uncharacterized protein Sb03g034800 OS=Sorghum bicolor GN=Sb03g034800 PE=4 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 2.017e-24
Identity = 54/79 (68.35%), Postives = 68/79 (86.08%), Query Frame = 1
Query:    4 ADENTKAKGVQGVIEIENPNLVKPKNIKARDIDIGKTSELSXXXXXXIEKQRAHERYMKLQEQGKTEQSRKDLDRLALI 240
            +D+  K KG +G+I+IENPNLVK KNIKA+++D+GKT+ELS      +EKQ+AHERYMKLQEQGKTEQ+RKDL+RLALI
Sbjct:   59 SDDKPKHKGTEGIIQIENPNLVKAKNIKAKEVDLGKTTELSRREREELEKQKAHERYMKLQEQGKTEQARKDLERLALI 137          
BLAST of FG534288 vs. TrEMBL
Match: B6SNE2_MAIZE (Heat-and acid-stable phosphoprotein OS=Zea mays PE=2 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 2.634e-24
Identity = 54/79 (68.35%), Postives = 68/79 (86.08%), Query Frame = 1
Query:    4 ADENTKAKGVQGVIEIENPNLVKPKNIKARDIDIGKTSELSXXXXXXIEKQRAHERYMKLQEQGKTEQSRKDLDRLALI 240
            +D+  K KG +G+I+IENPNLVK KNIKA+++D+GKT+ELS      +EKQ+AHERYMKLQEQGKTEQ+RKDL+RLALI
Sbjct:   58 SDDKPKHKGTEGIIQIENPNLVKVKNIKAKEVDLGKTTELSRREREELEKQKAHERYMKLQEQGKTEQARKDLERLALI 136          
BLAST of FG534288 vs. TrEMBL
Match: B9H2N6_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_831107 PE=4 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 4.492e-24
Identity = 53/78 (67.95%), Postives = 67/78 (85.90%), Query Frame = 1
Query:    7 DENTKAKGVQGVIEIENPNLVKPKNIKARDIDIGKTSELSXXXXXXIEKQRAHERYMKLQEQGKTEQSRKDLDRLALI 240
            D + K KG QG+I+IENPN+VK KN+KA+D+D+GKT+ELS      IEKQRAHERYM+LQEQGKT+Q+RKDL+RL+LI
Sbjct:   56 DSDQKRKGTQGIIQIENPNMVKAKNLKAKDVDMGKTTELSRREREEIEKQRAHERYMRLQEQGKTDQARKDLERLSLI 133          
BLAST of FG534288 vs. TrEMBL
Match: Q75IJ8_ORYSJ (Putative uncharacterized protein OS=Oryza sativa subsp. japonica GN=B1130G10.4 PE=4 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 7.663e-24
Identity = 54/77 (70.13%), Postives = 66/77 (85.71%), Query Frame = 1
Query:   10 ENTKAKGVQGVIEIENPNLVKPKNIKARDIDIGKTSELSXXXXXXIEKQRAHERYMKLQEQGKTEQSRKDLDRLALI 240
            +  K KG +G+IEIENPNLVKPKNIKA+DIDIG+TS+LS      +EKQ++HER+MKLQEQGKTEQ+RKDL+RL LI
Sbjct:   69 QKNKHKGTEGLIEIENPNLVKPKNIKAKDIDIGRTSDLSRREREELEKQKSHERHMKLQEQGKTEQARKDLERLTLI 145          
BLAST of FG534288 vs. TrEMBL
Match: A2Y6I6_ORYSI (Putative uncharacterized protein OS=Oryza sativa subsp. indica GN=OsI_20626 PE=4 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 7.663e-24
Identity = 54/77 (70.13%), Postives = 66/77 (85.71%), Query Frame = 1
Query:   10 ENTKAKGVQGVIEIENPNLVKPKNIKARDIDIGKTSELSXXXXXXIEKQRAHERYMKLQEQGKTEQSRKDLDRLALI 240
            +  K KG +G+IEIENPNLVKPKNIKA+DIDIG+TS+LS      +EKQ++HER+MKLQEQGKTEQ+RKDL+RL LI
Sbjct:   69 QKNKHKGTEGLIEIENPNLVKPKNIKAKDIDIGRTSDLSRHEREELEKQKSHERHMKLQEQGKTEQARKDLERLTLI 145          
BLAST of FG534288 vs. TrEMBL
Match: Q5JMX3_ORYSJ (Os01g0752800 protein OS=Oryza sativa subsp. japonica GN=P0435B05.27 PE=4 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 1.307e-23
Identity = 54/79 (68.35%), Postives = 67/79 (84.81%), Query Frame = 1
Query:    4 ADENTKAKGVQGVIEIENPNLVKPKNIKARDIDIGKTSELSXXXXXXIEKQRAHERYMKLQEQGKTEQSRKDLDRLALI 240
            ++   K KG +G+I+IENPNLVK KNIKA+++D+GKT+ELS      IEKQ+AHERYMKLQEQGKTEQ+RKDL+RLALI
Sbjct:   61 SEGKAKHKGTEGLIQIENPNLVKAKNIKAKEVDLGKTTELSRREREEIEKQKAHERYMKLQEQGKTEQARKDLERLALI 139          
BLAST of FG534288 vs. SwissProt
Match: HAP28_RAT (28 kDa heat- and acid-stable phosphoprotein OS=Rattus norvegicus GN=Pdap1 PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 3.693e-13
Identity = 39/78 (50.00%), Postives = 49/78 (62.82%), Query Frame = 1
Query:    7 DENTKAKGVQGVIEIENPNLVKPKNIKARDIDIGKTSELSXXXXXXIEKQRAHERYMKLQEQGKTEQSRKDLDRLALI 240
            D   K KGV+G+I+IENPN V     K   +D+    ELS      IEKQ+A ERYMK+   GKTEQ++ DL RLA+I
Sbjct:   69 DYQQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKAKERYMKMHLAGKTEQAKADLARLAII 146          
BLAST of FG534288 vs. SwissProt
Match: HAP28_MOUSE (28 kDa heat- and acid-stable phosphoprotein OS=Mus musculus GN=Pdap1 PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 3.693e-13
Identity = 39/78 (50.00%), Postives = 49/78 (62.82%), Query Frame = 1
Query:    7 DENTKAKGVQGVIEIENPNLVKPKNIKARDIDIGKTSELSXXXXXXIEKQRAHERYMKLQEQGKTEQSRKDLDRLALI 240
            D   K KGV+G+I+IENPN V     K   +D+    ELS      IEKQ+A ERYMK+   GKTEQ++ DL RLA+I
Sbjct:   69 DYQQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKAKERYMKMHLAGKTEQAKADLARLAII 146          
BLAST of FG534288 vs. SwissProt
Match: HAP28_HUMAN (28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens GN=PDAP1 PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 3.693e-13
Identity = 39/78 (50.00%), Postives = 49/78 (62.82%), Query Frame = 1
Query:    7 DENTKAKGVQGVIEIENPNLVKPKNIKARDIDIGKTSELSXXXXXXIEKQRAHERYMKLQEQGKTEQSRKDLDRLALI 240
            D   K KGV+G+I+IENPN V     K   +D+    ELS      IEKQ+A ERYMK+   GKTEQ++ DL RLA+I
Sbjct:   69 DYQQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKAKERYMKMHLAGKTEQAKADLARLAII 146          
BLAST of FG534288 vs. TAIR peptide
Match: AT5G46020.1 (| Symbols: | CONTAINS InterPro DOMAIN/s: Casein kinase substrate, phosphoprotein PP28 (InterPro:IPR019380); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). | chr5:18663075-18664629 REVERSE LENGTH=164)

HSP 1 Score: 104.375 bits (259), Expect = 4.604e-23
Identity = 49/78 (62.82%), Postives = 62/78 (79.49%), Query Frame = 1
Query:    7 DENTKAKGVQGVIEIENPNLVKPKNIKARDIDIGKTSELSXXXXXXIEKQRAHERYMKLQEQGKTEQSRKDLDRLALI 240
            + + K KG + VIE++NPN V+ K +KA+D+D  KT+ELS      +EKQRAHERYM+LQEQGKTEQ+RKDLDRLALI
Sbjct:   60 EADVKKKGAEAVIEVDNPNRVRQKTLKAKDLDASKTTELSRREREELEKQRAHERYMRLQEQGKTEQARKDLDRLALI 137          
The following BLAST results are available for this feature:
BLAST of FG534288 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
C6TGZ5_SOYBN3.675e-2674.36Putative uncharacterized protein OS=Glycine max PE... [more]
B4FS53_MAIZE3.111e-2570.89Heat-and acid-stable phosphoprotein OS=Zea mays PE... [more]
B9S940_RICCO4.063e-2571.7928 kDa heat-and acid-stable phosphoprotein, putati... [more]
A9PBP5_POPTR9.052e-2571.79Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
C5XK58_SORBI2.017e-2468.35Putative uncharacterized protein Sb03g034800 OS=So... [more]
B6SNE2_MAIZE2.634e-2468.35Heat-and acid-stable phosphoprotein OS=Zea mays PE... [more]
B9H2N6_POPTR4.492e-2467.95Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
Q75IJ8_ORYSJ7.663e-2470.13Putative uncharacterized protein OS=Oryza sativa s... [more]
A2Y6I6_ORYSI7.663e-2470.13Putative uncharacterized protein OS=Oryza sativa s... [more]
Q5JMX3_ORYSJ1.307e-2368.35Os01g0752800 protein OS=Oryza sativa subsp. japoni... [more]
back to top
BLAST of FG534288 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Swissprot)
Total hits: 3
Match NameE-valueIdentityDescription
HAP28_RAT3.693e-1350.0028 kDa heat- and acid-stable phosphoprotein OS=Rat... [more]
HAP28_MOUSE3.693e-1350.0028 kDa heat- and acid-stable phosphoprotein OS=Mus... [more]
HAP28_HUMAN3.693e-1350.0028 kDa heat- and acid-stable phosphoprotein OS=Hom... [more]
back to top
BLAST of FG534288 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide)
Total hits: 1
Match NameE-valueIdentityDescription
AT5G46020.14.604e-2362.82| Symbols: | CONTAINS InterPro DOMAIN/s: Casein k... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019380Casein kinase substrate, phosphoprotein PP28PFAMPF10252PP28coord: 18..97
score: 1
NoneNo IPR availablePANTHERPTHR2205528 KDA HEAT- AND ACID-STABLE PHOSPHOPROTEIN (PDGF-ASSOCIATED PROTEIN)coord: 2..106
score: 1.8
NoneNo IPR availableSEGsegsegcoord: 43..48
score: NAcoord: 81..102
score

Properties
Property NameValue
Singlet in analysisPisum sativum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>FG534288 ID=FG534288|Name=FG534288|organism=Pisum sativum|type=EST|length=581bp
TGTGCAGATGAAAATACTAAGGCAAAGGGTGTTCAAGGGGTTATCGAGAT
TGAAAATCCTAACTTGGTAAAGCCCAAGAACATTAAAGCCAGAGACATTG
ATATTGGGAAAACCAGTGAGCTTTCAAGGCGTGAAAGAGAGGAGATTGAA
AAACAAAGAGCTCATGAGCGCTACATGAAACTTCAAGAGCAAGGAAAAAC
AGAACAATCCAGGAAAGATCTAGATCGTTTAGCTCTGATACGTCAAGAAA
GAGCTGAAGCTGCTAAAAAGCGAGAAGAAGAGAGATTGGCCAAAGAACAA
AAGAAGACCGAAGCTCGCAAGTAAATTTCGTGGGGGATGTTGCGTGTCTA
AGTTTTACTCCTATTTGCTGGAGGAATATTCGCATTAGCTATATTTCAAC
ATTTTATATGTCCATTGTCTTTATATTGAATATGAACATTCCATGTTGGT
AGCATGTTTCTCTTCACTTAATGACTTGAAATTTAAGTTTTACATGTTTT
ATTCTCCGTAGGTTTCAAGATCAAAATTCAGTTAAGTATAATTTTTGCTG
TGCTTAGCACAAATTTCTATTTGAGTTTTAT
back to top
Annotated Terms
The following terms have been associated with this EST:
Vocabulary: INTERPRO
TermDefinition
IPR019380Casein_kinase_sb_PP28