GH720768

EST Overview
NameGH720768
Unique NameGH720768
TypeEST
OrganismPisum sativum (pea)
Sequence length410
Libraries
Library NameType
LIBEST_024273 BACNIcdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Pisum sativum unigene v1Pisum sativum unigene v1EST
Homology
BLAST of GH720768 vs. TrEMBL
Match: B9HRF8_POPTR (Global transcription factor group OS=Populus trichocarpa GN=GTA902 PE=4 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 8.379e-56
Identity = 103/132 (78.03%), Postives = 113/132 (85.61%), Query Frame = 2
Query:   20 QVRQGSYKGYRGRVIQVKGTFVRVELESQMKVVT-------VDRNHITDNVAV-TPQRETSRYGMGSETPIHPSRTPLHPYITPMRDPGATPIHDGMRTPMRDRAWNPYAPMSPARDNWEDGNPGSWGASPR 391
            +VRQG +KGYRGRV+ +KG FVRVELESQMKVVT       VDR+HI+DNV V TP R+  RYGMGSETP+HPSRTPL PY+TPMRD GATPIHDGMRTPMRDRAWNPYAPMSP RDNWEDGNPGSWG SP+
Sbjct:  707 KVRQGPFKGYRGRVVDIKGQFVRVELESQMKVVTGKYSSMSVDRSHISDNVVVSTPYRDAPRYGMGSETPMHPSRTPLRPYMTPMRDSGATPIHDGMRTPMRDRAWNPYAPMSPPRDNWEDGNPGSWGTSPQ 838          
BLAST of GH720768 vs. TrEMBL
Match: B9SJK4_RICCO (Suppressor of ty, putative OS=Ricinus communis GN=RCOM_0138850 PE=4 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 4.598e-54
Identity = 98/130 (75.38%), Postives = 112/130 (86.15%), Query Frame = 2
Query:    8 GRPGQVRQGSYKGYRGRVIQVKGTFVRVELESQMKVVT--VDRNHITDNVAV-TPQRETSRYGMGSETPIHPSRTPLHPYITPMRDPGATPIHDGMRTPMRDRAWNPYAPMSPARDNWEDGNPGSWGASP 388
            G   ++R G +KGYRGRV+++KG  VRVELESQMKV+    DRN+I+DNV + TP R++SRYGMGSETP+HPSRTPLHPY+TPMRD GATPIHDGMRTPMRDRAWNPYAPMSP RDNWEDGNP SWG SP
Sbjct:  711 GTTVKIRLGPFKGYRGRVVEIKGPSVRVELESQMKVILGKFDRNNISDNVVISTPHRDSSRYGMGSETPMHPSRTPLHPYMTPMRDAGATPIHDGMRTPMRDRAWNPYAPMSPPRDNWEDGNPASWGTSP 840          
BLAST of GH720768 vs. TrEMBL
Match: A5BMK7_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_043874 PE=4 SV=1)

HSP 1 Score: 201.445 bits (511), Expect = 2.361e-50
Identity = 95/129 (73.64%), Postives = 105/129 (81.40%), Query Frame = 2
Query:   20 QVRQGSYKGYRGRVIQVKGTFVRVELESQMK---------VVTVDRNHITDNVAV-TPQRETSRYGMGSETPIHPSRTPLHPYITPMRDPGATPIHDGMRTPMRDRAWNPYAPMSPARDNWEDGNPGSW 376
            ++RQG +KGYRGRV+ V G  VRVELESQMK         +  VDRN I+DNVAV TP R+  RYGMGSETP+HPSRTPLHPY+TPMRD GATPIHDGMRTPMRDRAWNPYAPMSP RDNWE+GNP SW
Sbjct:  707 KIRQGPFKGYRGRVVDVNGQSVRVELESQMKFPDWMMTAFICAVDRNQISDNVAVATPYRDAPRYGMGSETPMHPSRTPLHPYMTPMRDVGATPIHDGMRTPMRDRAWNPYAPMSPPRDNWEEGNPDSW 835          
BLAST of GH720768 vs. TrEMBL
Match: D7M8E2_ARALY (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_327088 PE=4 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 1.388e-42
Identity = 89/153 (58.17%), Postives = 102/153 (66.67%), Query Frame = 2
Query:    8 GRPGQVRQGSYKGYRGRVIQVKGTFVRVELESQMKVVTVDRNHITDNVAVTPQR-------------------------ETSRYGMGSETPIHPSRTPLHPYITPMRDPGATPIHDGMRTPMRDRAWNPYAPMSPARDNWEDGNPGSWGASPR 391
            G   ++R G +KGYRG V++VKG  VRVELE  MK+VT    +    + V+  R                         +TSRY MGSETP+HPSRTPLHPY+TPMRD GATPIHDGMRTPMRDRAWNPY PMSP RDNWEDGNPGSWG SP+
Sbjct:  701 GTTVKIRLGPFKGYRGPVVEVKGNSVRVELE--MKIVTGKLLNSLFRMWVSTCRRNFNNSLYMQLIGMQYQIMLRQHPLDTSRYSMGSETPMHPSRTPLHPYMTPMRDSGATPIHDGMRTPMRDRAWNPYTPMSPPRDNWEDGNPGSWGTSPQ 851          
BLAST of GH720768 vs. TrEMBL
Match: C5Z6D8_SORBI (Putative uncharacterized protein Sb10g006840 OS=Sorghum bicolor GN=Sb10g006840 PE=4 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 1.812e-42
Identity = 87/134 (64.93%), Postives = 99/134 (73.88%), Query Frame = 2
Query:    8 GRPGQVRQGSYKGYRGRVIQVKGTFVRVELESQMKVVTVDRNHITDNVAV-TPQRETSRYGMGSETPIHPSRTPLHPYITPMRDPGATPIHDGMRTPMRDRAWNPYAPMSPARDNWEDGNPGSWGASPRTSAAT 406
            G+  +++ G YKGYRGRV +V G  VRVEL+S MK+VTV R+ I D   V TP RE  RY +G ETP+HPSRTP H Y TPMRDPGATPIHDGMRTPMR RAW   APMSP RDNWEDGNP +WG+SP     T
Sbjct:  702 GKCIKIKSGPYKGYRGRVKEVTGALVRVELDSLMKIVTVKRDDIADTPTVATPFREP-RYSLGGETPMHPSRTPHHAYQTPMRDPGATPIHDGMRTPMRSRAW---APMSPPRDNWEDGNPATWGSSPAYQPGT 831          
BLAST of GH720768 vs. TrEMBL
Match: B9FS39_ORYSJ (Putative uncharacterized protein OS=Oryza sativa subsp. japonica GN=OsJ_20538 PE=4 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 1.175e-41
Identity = 87/134 (64.93%), Postives = 100/134 (74.63%), Query Frame = 2
Query:    8 GRPGQVRQGSYKGYRGRVIQVKGTFVRVELESQMKVVTVDRNHITDNVAV-TPQRETSRYGMGSETPIHPSRTPLHPYITPMRDPGATPIHDGMRTPMRDRAWNPYAPMSPARDNWEDGNPGSWGASPRTSAAT 406
            G+  +++ G YKGYRGRV +V G  VRVEL+S MK+VTV R+ I D   V TP RE  RY +G ETP+HPSRTPLHPY TPMRDPGATPIHDGMRTPMR R W   APMSP RDNWE+GNP +WG+SP     T
Sbjct:  685 GKCIKIKSGPYKGYRGRVKEVTGVLVRVELDSLMKIVTVKRDDIADTPTVATPFREP-RYPLGGETPMHPSRTPLHPYQTPMRDPGATPIHDGMRTPMR-RGW---APMSPPRDNWEEGNPATWGSSPAYQPGT 813          
BLAST of GH720768 vs. TrEMBL
Match: B8B3X6_ORYSI (Putative uncharacterized protein OS=Oryza sativa subsp. indica GN=OsI_22102 PE=4 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 1.175e-41
Identity = 87/134 (64.93%), Postives = 100/134 (74.63%), Query Frame = 2
Query:    8 GRPGQVRQGSYKGYRGRVIQVKGTFVRVELESQMKVVTVDRNHITDNVAV-TPQRETSRYGMGSETPIHPSRTPLHPYITPMRDPGATPIHDGMRTPMRDRAWNPYAPMSPARDNWEDGNPGSWGASPRTSAAT 406
            G+  +++ G YKGYRGRV +V G  VRVEL+S MK+VTV R+ I D   V TP RE  RY +G ETP+HPSRTPLHPY TPMRDPGATPIHDGMRTPMR R W   APMSP RDNWE+GNP +WG+SP     T
Sbjct:  797 GKCIKIKSGPYKGYRGRVKEVTGVLVRVELDSLMKIVTVKRDDIADTPTVATPFREP-RYPLGGETPMHPSRTPLHPYQTPMRDPGATPIHDGMRTPMR-RGW---APMSPPRDNWEEGNPATWGSSPAYQPGT 925          
BLAST of GH720768 vs. TrEMBL
Match: D7LGY4_ARALY (KOW domain-containing transcription factor family protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_482364 PE=4 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 2.617e-41
Identity = 86/130 (66.15%), Postives = 99/130 (76.15%), Query Frame = 2
Query:   20 QVRQGSYKGYRGRVIQVKGTFVRVELESQMKVVT----VDRNHI---TDNVAVTPQRETSRYGMGSETPIHPSRTPLHPYITPMRDPGATPIHDGMRTPMRDRAWNPYAPMSPARDNWEDGNPGSWGASP 388
            ++R G++KGY GR+++VK   VRVELE+  K+VT     +R  I   TDNVA TP    S Y MGS+TP+HPSRTPLHP +TPMRD GATPIHDGMRTPMR RAWNPY PMSP RDNWEDGNPGSWG  P
Sbjct:  676 KIRMGAFKGYSGRLVEVKDKLVRVELEA--KIVTGKLHFERTAISDMTDNVA-TP----SHYNMGSQTPMHPSRTPLHPCMTPMRDSGATPIHDGMRTPMRGRAWNPYMPMSPPRDNWEDGNPGSWGTGP 798          
BLAST of GH720768 vs. TrEMBL
Match: A9SZZ9_PHYPA (RNA polymerase II transcription elongation factor SPT5 OS=Physcomitrella patens subsp. patens GN=GTA1501 PE=4 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 2.372e-34
Identity = 79/148 (53.38%), Postives = 96/148 (64.86%), Query Frame = 2
Query:    8 GRPGQVRQGSYKGYRGRVIQVKGTFVRVELESQMKVVTVDRNH------ITDNVAVTPQ---------RETSRYGMGSETPIHPSRTPLH--PYITPMRDPG-ATPIHDGMRTPMRDRAWNPYAPMSPAR-DNWEDGNPGSWGASPRT 394
            GR  ++R G +KGYRGRV+    + VR+ELESQMKVVT           IT N+ V P+           + RYG GSETP+HPSRTP+H   Y+TPMRDP  ATP HDGMRTPMRDRAWNP+ PM+P R +NW+D NP +W     T
Sbjct:  697 GRSVKIRLGPFKGYRGRVVDATDSTVRIELESQMKVVTGAFPSGFYCLMITRNLGVVPRLFLGFRACVTSSPRYGAGSETPMHPSRTPMHHPAYMTPMRDPNFATPSHDGMRTPMRDRAWNPHTPMTPHRGNNWDDANPSTWDTHTST 844          
BLAST of GH720768 vs. TrEMBL
Match: C7IY85_ORYSJ (Os02g0772000 protein OS=Oryza sativa subsp. japonica GN=Os02g0772000 PE=4 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 2.455e-31
Identity = 69/129 (53.49%), Postives = 84/129 (65.12%), Query Frame = 2
Query:   20 QVRQGSYKGYRGRVIQVKGTFVRVELESQMKVVTVDRNHITDNVAVTPQRETSRYGMGSETPIHPSRTPLHPYITPMRDPGATPIHDGMRTPMRDRAWNPYAPMSPARDNWEDGNPGSWGASPRTSAAT 406
            +++ G YKGYRGRV ++ G  VRVEL+S MKVV V R  I D   V      S    G+ETP+HPSRTPL P+ TP+RDPGATP+ +GMRTPM  RAW   APMSP R+ WED    +W +SP     T
Sbjct:  639 KIKSGPYKGYRGRVKEMTGALVRVELDSLMKVVAVKREDIADTATVATPFGESHNSWGNETPVHPSRTPLRPFQTPLRDPGATPVPNGMRTPMPSRAW---APMSPPRNGWEDA--VTWESSPTYQPGT 762          
BLAST of GH720768 vs. SwissProt
Match: SPT51_ARATH (Putative transcription elongation factor SPT5 homolog 1 OS=Arabidopsis thaliana GN=At4g08350 PE=1 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 4.005e-44
Identity = 90/153 (58.82%), Postives = 102/153 (66.67%), Query Frame = 2
Query:    8 GRPGQVRQGSYKGYRGRVIQVKGTFVRVELESQMKVVTVDRNHITDNVAVTPQR-------------------------ETSRYGMGSETPIHPSRTPLHPYITPMRDPGATPIHDGMRTPMRDRAWNPYAPMSPARDNWEDGNPGSWGASPR 391
            G   ++R G +KGYRG V++VKG  VRVELE  MK+VT    +    V V+  R                         +TSRY MGSETP+HPSRTPLHPY+TPMRD GATPIHDGMRTPMRDRAWNPY PMSP RDNWEDGNPGSWG SP+
Sbjct:  704 GTTVKIRLGPFKGYRGPVVEVKGNSVRVELE--MKIVTGKPLNSLLRVWVSTCRTNSNNSSYMQLIGVQYQIMLRQHRLDTSRYSMGSETPMHPSRTPLHPYMTPMRDSGATPIHDGMRTPMRDRAWNPYTPMSPPRDNWEDGNPGSWGTSPQ 854          
BLAST of GH720768 vs. SwissProt
Match: SPT52_ARATH (Putative transcription elongation factor SPT5 homolog 2 OS=Arabidopsis thaliana GN=At2g34210 PE=2 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 5.784e-43
Identity = 86/134 (64.18%), Postives = 99/134 (73.88%), Query Frame = 2
Query:   20 QVRQGSYKGYRGRVIQVKGTFVRVELESQMKVVT----VDRNHI---TDNVAVTPQRETSRYGMGSETPIHPSRTPLHPYITPMRDPGATPIHDGMRTPMRDRAWNPYAPMSPARDNWEDGNPGSWGASPRTSA 400
            ++R G +KGY GR+++VK   VRVELE+  K+VT     +R  I   TDNV  TPQ     Y MGS+TP+HPSRTPLHP +TPMR  GATPIHDGMRTPMR RAWNPY PMSP RDNWEDGNPGSWG SP  +A
Sbjct:  691 KIRLGPFKGYSGRLVEVKDKLVRVELEA--KIVTGKLHFERKAISDMTDNVVATPQ-----YNMGSQTPMHPSRTPLHPCMTPMRHSGATPIHDGMRTPMRGRAWNPYMPMSPPRDNWEDGNPGSWGTSPYEAA 817          
BLAST of GH720768 vs. SwissProt
Match: SPT5H_MOUSE (Transcription elongation factor SPT5 OS=Mus musculus GN=Supt5h PE=1 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 1.028e-15
Identity = 52/149 (34.90%), Postives = 78/149 (52.35%), Query Frame = 2
Query:    8 GRPGQVRQGSYKGYRGRVIQVKGTFVRVELESQMKVVTVDRNHITDNVAVTPQRETSRYG----MGSETPIH--PSRTPLHPYITPMRD-------PGATPIHDGMRTPMRDRAWNPYAPMSPAR---------DNWEDGNPGSWGASP 388
            G+  ++ QG YKGY G V     +  RVEL S  + ++VDR  +T   +  P   TS YG     GS+TP++   SRTP++   TP++D          TP+HDG RTP +  AW+P  P +P+R         D+    +P ++G +P
Sbjct:  701 GQTVRISQGPYKGYIGVVKDATESTARVELHSTCQTISVDRQRLTTVDSQRPGGMTSTYGRTPMYGSQTPMYGSGSRTPMYGSQTPLQDGSRTPHYGSQTPLHDGSRTPAQSGAWDPNNPNTPSRAEEEYEYAFDDEPTPSPQAYGGTP 849          
BLAST of GH720768 vs. SwissProt
Match: SPT5H_PONAB (Transcription elongation factor SPT5 OS=Pongo abelii GN=SUPT5H PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 1.343e-15
Identity = 52/149 (34.90%), Postives = 78/149 (52.35%), Query Frame = 2
Query:    8 GRPGQVRQGSYKGYRGRVIQVKGTFVRVELESQMKVVTVDRNHITDNVAVTPQRETSRYG----MGSETPIH--PSRTPLHPYITPMRD-------PGATPIHDGMRTPMRDRAWNPYAPMSPAR---------DNWEDGNPGSWGASP 388
            G+  ++ QG YKGY G V     +  RVEL S  + ++VDR  +T   +  P   TS YG     GS+TP++   SRTP++   TP++D          TP+HDG RTP +  AW+P  P +P+R         D+    +P ++G +P
Sbjct:  703 GQTVRISQGPYKGYIGVVKDATESTARVELHSTCQTISVDRQRLTTVGSRRPGGMTSTYGRTPMYGSQTPMYGSGSRTPMYGSQTPLQDGSRTPHYGSQTPLHDGSRTPAQSGAWDPNNPNTPSRAEEEYEYAFDDEPTPSPQAYGGTP 851          
BLAST of GH720768 vs. SwissProt
Match: SPT5H_HUMAN (Transcription elongation factor SPT5 OS=Homo sapiens GN=SUPT5H PE=1 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 1.343e-15
Identity = 52/149 (34.90%), Postives = 78/149 (52.35%), Query Frame = 2
Query:    8 GRPGQVRQGSYKGYRGRVIQVKGTFVRVELESQMKVVTVDRNHITDNVAVTPQRETSRYG----MGSETPIH--PSRTPLHPYITPMRD-------PGATPIHDGMRTPMRDRAWNPYAPMSPAR---------DNWEDGNPGSWGASP 388
            G+  ++ QG YKGY G V     +  RVEL S  + ++VDR  +T   +  P   TS YG     GS+TP++   SRTP++   TP++D          TP+HDG RTP +  AW+P  P +P+R         D+    +P ++G +P
Sbjct:  707 GQTVRISQGPYKGYIGVVKDATESTARVELHSTCQTISVDRQRLTTVGSRRPGGMTSTYGRTPMYGSQTPMYGSGSRTPMYGSQTPLQDGSRTPHYGSQTPLHDGSRTPAQSGAWDPNNPNTPSRAEEEYEYAFDDEPTPSPQAYGGTP 855          
BLAST of GH720768 vs. SwissProt
Match: SPT5H_CHICK (Transcription elongation factor SPT5 OS=Gallus gallus GN=SUPT5H PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 1.754e-15
Identity = 51/149 (34.23%), Postives = 74/149 (49.66%), Query Frame = 2
Query:    8 GRPGQVRQGSYKGYRGRVIQVKGTFVRVELESQMKVVTVDRNHI-----------TDNVAVTPQ--RETSRYGMGSETPIHPSRTPLHPYITPMRDPGATPIHDGMRTPMRDRAWNPYAPMSPAR--DNWEDG-------NPGSWGASP 388
            G+  ++ QG YKGY G V     +  RVEL S  + ++VDR  +           T     TP    +T  YG GS TP++ S+TPLH           TP+HDG RTP +  AW+P  P +P+R  +++E G       +P  +G +P
Sbjct:  699 GQTVRISQGPYKGYIGVVKDATESTARVELHSTCQTISVDRQRLTTVGSRRPGGMTSTYGRTPMYGSQTPMYGSGSRTPMYGSQTPLHDGSRTPHYGSQTPLHDGSRTPAQSGAWDPNNPNTPSRADEDFEYGFDDEPTPSPQGYGGTP 847          
BLAST of GH720768 vs. SwissProt
Match: SPT5H_DANRE (Transcription elongation factor SPT5 OS=Danio rerio GN=supt5h PE=1 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 1.137e-14
Identity = 50/149 (33.56%), Postives = 71/149 (47.65%), Query Frame = 2
Query:    8 GRPGQVRQGSYKGYRGRVIQVKGTFVRVELESQMKVVTVDRNHIT-----------DNVAVTPQ--RETSRYGMGSETPIHPSRTPLHPYITPMRDPGATPIHDGMRTPMRDRAWNPYAPMSPAR---------DNWEDGNPGSWGASP 388
            G+  ++ QG YKGY G V     +  RVEL S  + ++VDR  +T                TP    +T  YG GS TP++ S+TPLH           TP+HDG RTP +  AW+P  P +P+R         D+    +P  +G +P
Sbjct:  705 GQTVRISQGPYKGYIGVVKDATESTARVELHSTCQTISVDRQRLTTVGGKERQGRSSTHLRTPMYGSQTPIYGTGSRTPMYGSQTPLHDGSRTPHYGSQTPLHDGSRTPGQSGAWDPNNPNTPSRPDDEYEFAYDDEPSPSPQGYGGTP 853          
BLAST of GH720768 vs. SwissProt
Match: SPT5H_DROME (Transcription elongation factor SPT5 OS=Drosophila melanogaster GN=Spt5 PE=1 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 1.101e-9
Identity = 46/132 (34.85%), Postives = 62/132 (46.97%), Query Frame = 2
Query:    8 GRPGQVRQGSYKGYRGRVIQVKGTFVRVELESQMKVVTVDRNHITDNVAVTPQRETSRY--------GMGSETPIHP---SRTPLHPYITPMRDPGA-------TPIHDGMRTPMRDRAWNPYAPMSPARDN 349
            G+  ++  G YKG  G V     +  RVEL +  + ++VDRNHI        +   S Y        G G++TP +    S+TPL    TP  D          TP HDG  TP R  AW+P A  +PAR+N
Sbjct:  743 GKTIKISGGPYKGAVGIVKDATESTARVELHTSCQTISVDRNHIAIVGVTGKEGSVSTYGRTPARTPGYGAQTPSYTAAGSKTPLVGSQTPNWDTDTRTPYGTMTPSHDGSMTP-RHGAWDPTANTTPARNN 873          
BLAST of GH720768 vs. TAIR peptide
Match: AT4G08350.1 (| Symbols: GTA02, GTA2 | global transcription factor group A2 | chr4:5286351-5292072 FORWARD LENGTH=1041)

HSP 1 Score: 213.386 bits (542), Expect = 3.356e-56
Identity = 98/128 (76.56%), Postives = 109/128 (85.16%), Query Frame = 2
Query:    8 GRPGQVRQGSYKGYRGRVIQVKGTFVRVELESQMKVVTVDRNHITDNVAVTPQRETSRYGMGSETPIHPSRTPLHPYITPMRDPGATPIHDGMRTPMRDRAWNPYAPMSPARDNWEDGNPGSWGASPR 391
            G   ++R G +KGYRG V++VKG  VRVELE  MK+VTVDR  I+DNVA TP R+TSRY MGSETP+HPSRTPLHPY+TPMRD GATPIHDGMRTPMRDRAWNPY PMSP RDNWEDGNPGSWG SP+
Sbjct:  716 GTTVKIRLGPFKGYRGPVVEVKGNSVRVELE--MKIVTVDRGAISDNVATTPFRDTSRYSMGSETPMHPSRTPLHPYMTPMRDSGATPIHDGMRTPMRDRAWNPYTPMSPPRDNWEDGNPGSWGTSPQ 841          
BLAST of GH720768 vs. TAIR peptide
Match: AT2G34210.1 (| Symbols: | Transcription elongation factor Spt5 | chr2:14445938-14450522 FORWARD LENGTH=989)

HSP 1 Score: 180.259 bits (456), Expect = 3.148e-46
Identity = 87/130 (66.92%), Postives = 100/130 (76.92%), Query Frame = 2
Query:   20 QVRQGSYKGYRGRVIQVKGTFVRVELESQMKVVTVDRNHI---TDNVAVTPQRETSRYGMGSETPIHPSRTPLHPYITPMRDPGATPIHDGMRTPMRDRAWNPYAPMSPARDNWEDGNPGSWGASPRTSA 400
            ++R G +KGY GR+++VK   VRVELE+  K+VTV+R  I   TDNV  TPQ     Y MGS+TP+HPSRTPLHP +TPMR  GATPIHDGMRTPMR RAWNPY PMSP RDNWEDGNPGSWG SP  +A
Sbjct:  691 KIRLGPFKGYSGRLVEVKDKLVRVELEA--KIVTVERKAISDMTDNVVATPQ-----YNMGSQTPMHPSRTPLHPCMTPMRHSGATPIHDGMRTPMRGRAWNPYMPMSPPRDNWEDGNPGSWGTSPYEAA 813          
The following BLAST results are available for this feature:
BLAST of GH720768 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
B9HRF8_POPTR8.379e-5678.03Global transcription factor group OS=Populus trich... [more]
B9SJK4_RICCO4.598e-5475.38Suppressor of ty, putative OS=Ricinus communis GN=... [more]
A5BMK7_VITVI2.361e-5073.64Putative uncharacterized protein OS=Vitis vinifera... [more]
D7M8E2_ARALY1.388e-4258.17Putative uncharacterized protein OS=Arabidopsis ly... [more]
C5Z6D8_SORBI1.812e-4264.93Putative uncharacterized protein Sb10g006840 OS=So... [more]
B9FS39_ORYSJ1.175e-4164.93Putative uncharacterized protein OS=Oryza sativa s... [more]
B8B3X6_ORYSI1.175e-4164.93Putative uncharacterized protein OS=Oryza sativa s... [more]
D7LGY4_ARALY2.617e-4166.15KOW domain-containing transcription factor family ... [more]
A9SZZ9_PHYPA2.372e-3453.38RNA polymerase II transcription elongation factor ... [more]
C7IY85_ORYSJ2.455e-3153.49Os02g0772000 protein OS=Oryza sativa subsp. japoni... [more]
back to top
BLAST of GH720768 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Swissprot)
Total hits: 8
Match NameE-valueIdentityDescription
SPT51_ARATH4.005e-4458.82Putative transcription elongation factor SPT5 homo... [more]
SPT52_ARATH5.784e-4364.18Putative transcription elongation factor SPT5 homo... [more]
SPT5H_MOUSE1.028e-1534.90Transcription elongation factor SPT5 OS=Mus muscul... [more]
SPT5H_PONAB1.343e-1534.90Transcription elongation factor SPT5 OS=Pongo abel... [more]
SPT5H_HUMAN1.343e-1534.90Transcription elongation factor SPT5 OS=Homo sapie... [more]
SPT5H_CHICK1.754e-1534.23Transcription elongation factor SPT5 OS=Gallus gal... [more]
SPT5H_DANRE1.137e-1433.56Transcription elongation factor SPT5 OS=Danio reri... [more]
SPT5H_DROME1.101e-934.85Transcription elongation factor SPT5 OS=Drosophila... [more]
back to top
BLAST of GH720768 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide)
Total hits: 2
Match NameE-valueIdentityDescription
AT4G08350.13.356e-5676.56| Symbols: GTA02, GTA2 | global transcription fact... [more]
AT2G34210.13.148e-4666.92| Symbols: | Transcription elongation factor Spt5... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR11125SUPPRESSOR OF TY 5coord: 8..129
score: 2.1

Properties
Property NameValue
Singlet in analysisPisum sativum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>GH720768 ID=GH720768|Name=GH720768|organism=Pisum sativum|type=EST|length=410bp
TTCGAGCGGCCGCCCNGGGCAGGTACGCCAGGGTTCGTATAAAGGTTATC
GTGGGCGTGTTATACAAGTTAAAGGAACATTTGTTCGGGTTGAATTGGAG
TCTCAGATGAAGGTTGTAACAGTTGATCGCAATCATATAACAGATAATGT
GGCTGTTACCCCACAACGTGAAACATCTCGATATGGAATGGGAAGTGAAA
CCCCAATACATCCATCTCGAACTCCCTTGCATCCATATATCACTCCAATG
AGAGATCCCGGAGCAACTCCAATTCATGATGGAATGAGGACACCTATGCG
TGACCGTGCTTGGAATCCTTATGCACCAATGAGTCCTGCTAGGGATAACT
GGGAAGATGGAAATCCAGGCTCTTGGGGAGCCAGTCCACGTACCTCGGCC
GCGACCACGC
back to top