GH720913

EST Overview
NameGH720913
Unique NameGH720913
TypeEST
OrganismPisum sativum (pea)
Sequence length341
Libraries
Library NameType
LIBEST_024273 BACNIcdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Pisum sativum unigene v1Pisum sativum unigene v1EST
Homology
BLAST of GH720913 vs. TrEMBL
Match: D7STZ9_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_8.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00035505001 PE=4 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 8.166e-27
Identity = 56/103 (54.37%), Postives = 79/103 (76.70%), Query Frame = 1
Query:   25 TKLQSQTWNYEFSDFPWPKRESSDYPTYAEILEYLHTYAVHFDLFKYVKFNSKVVEIKFIGDKEGFDFGRLH---RDSGNPLSGRPMWEFSVQSNESDTIQLY 324
            TKLQ+   ++EF+D+PWP+R++S +P++ EILEYLH YA HFD+ KYVK NSKVVE+++IGD+    F +L    R+ G  LSGRP+WE +VQ+N+S T+Q Y
Sbjct:   55 TKLQTPRCDFEFTDYPWPQRDNSSFPSHIEILEYLHNYASHFDVLKYVKLNSKVVEMRYIGDESESYFDQLETEPREYGRLLSGRPVWEVAVQTNQSPTLQWY 157          
BLAST of GH720913 vs. TrEMBL
Match: B9RR56_RICCO (Dimethylaniline monooxygenase, putative OS=Ricinus communis GN=RCOM_0709700 PE=4 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 1.393e-26
Identity = 54/100 (54.00%), Postives = 76/100 (76.00%), Query Frame = 1
Query:   25 TKLQSQTWNYEFSDFPWPKRESSDYPTYAEILEYLHTYAVHFDLFKYVKFNSKVVEIKFIGDKEGFDFGRLHRDSGNPLSGRPMWEFSVQSNESDTIQLY 324
            TKLQS   +YEFSDFPWP R+   +P++ EIL+YL +YA  FDLFK+++FNSKVVE++F+GD+E  D    + + G+ L G P+WE +VQ+N+SDT+Q Y
Sbjct:   54 TKLQSCRADYEFSDFPWPNRDDPSFPSHLEILDYLTSYAQCFDLFKHIRFNSKVVEVRFVGDREPADCNGTYGEYGSLLPGHPVWEVAVQTNDSDTVQWY 153          
BLAST of GH720913 vs. TrEMBL
Match: B9MT30_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_780975 PE=4 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 1.540e-25
Identity = 55/102 (53.92%), Postives = 74/102 (72.55%), Query Frame = 1
Query:   19 AGTKLQSQTWNYEFSDFPWPKRESSDYPTYAEILEYLHTYAVHFDLFKYVKFNSKVVEIKFIGDKEGFDFGRLHRDSGNPLSGRPMWEFSVQSNESDTIQLY 324
            + TKLQS   +YEF+DFPWP R+   +P+Y EIL+YL +YA HFD+ KYV FN+KVVE++F+G +E  D G    + G+ L G P+WE +VQS +SDTIQ Y
Sbjct:   52 SSTKLQSPRGDYEFTDFPWPNRDDPSFPSYIEILDYLKSYAEHFDVMKYVMFNTKVVEVRFVGGREPADSGE-PGEYGSLLPGLPVWEVAVQSKQSDTIQWY 152          
BLAST of GH720913 vs. TrEMBL
Match: B9GJB0_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_752663 PE=4 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 1.703e-24
Identity = 48/100 (48.00%), Postives = 75/100 (75.00%), Query Frame = 1
Query:   25 TKLQSQTWNYEFSDFPWPKRESSDYPTYAEILEYLHTYAVHFDLFKYVKFNSKVVEIKFIGDKEGFDFGRLHRDSGNPLSGRPMWEFSVQSNESDTIQLY 324
            TKLQ+   ++EFSD+PWP+R+++ +P++ ++LEYLH YA HFD+ KYVKFNSKVVEI+++GD+         ++ G+ L+G P WE +V++N+S  +Q Y
Sbjct:   56 TKLQTPRCDFEFSDYPWPERDNASFPSHVQVLEYLHNYATHFDVLKYVKFNSKVVEIRYVGDRTS-QLDMKPKEYGSLLNGNPAWEVAVETNQSTKVQWY 154          
BLAST of GH720913 vs. TrEMBL
Match: B9NF17_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_789813 PE=4 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 6.471e-24
Identity = 47/98 (47.96%), Postives = 74/98 (75.51%), Query Frame = 1
Query:   25 TKLQSQTWNYEFSDFPWPKRESSDYPTYAEILEYLHTYAVHFDLFKYVKFNSKVVEIKFIGDKEGFDFGRLHRDSGNPLSGRPMWEFSVQSNESDTIQ 318
            TKLQ+   ++EFSD+PWP+R+++ +P++ ++LEYLH YA HFD+ KYVKFNSKVVEI+++GD+         ++ G+ L+G P WE +V++N+S  +Q
Sbjct:   56 TKLQTPRCDFEFSDYPWPERDNASFPSHVQVLEYLHNYATHFDVLKYVKFNSKVVEIRYVGDRTS-QLDMKPKEYGSLLNGNPAWEVAVETNQSTKVQ 152          
BLAST of GH720913 vs. TrEMBL
Match: D7KHB6_ARALY (Flavin-dependent monooxygenase 1 OS=Arabidopsis lyrata subsp. lyrata GN=FMO1 PE=4 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 1.033e-21
Identity = 53/102 (51.96%), Postives = 71/102 (69.61%), Query Frame = 1
Query:   25 TKLQSQTWNYEFSDFPWPK-RESSDYPTYAEILEYLHTYAVHFDLFKYVKFNSKVVEIKFIGD---KEGFDFGRLHRDSGNPLSGRPMWEFSVQSNESDTIQ 318
            TKLQS   +YEFSDFPWP  R+ + +P+Y EIL+YL +YA HFDL K++KF SKV+E++FIGD    +  D G      GN L G+P+WE +VQ+ +S  IQ
Sbjct:   55 TKLQSARVDYEFSDFPWPNNRDDTTFPSYVEILDYLESYAKHFDLLKFMKFGSKVIEVRFIGDGQTPQMVDLGAY----GNLLPGKPVWEVAVQTGDSGDIQ 152          
BLAST of GH720913 vs. TrEMBL
Match: B9RR00_RICCO (Dimethylaniline monooxygenase, putative OS=Ricinus communis GN=RCOM_0708140 PE=4 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.142e-20
Identity = 46/100 (46.00%), Postives = 70/100 (70.00%), Query Frame = 1
Query:   25 TKLQSQTWNYEFSDFPWPKRESSDYPTYAEILEYLHTYAVHFDLFKYVKFNSKVVEIKFIGDKEGFDFGRLHRDSGNPLSGRPMWEFSVQSNESDTIQLY 324
            T+LQ+   ++EFSDFPWP+R++S +P++ EILEYL  YA HFD+ K+VKFNS+VV I+ +G+    D      + G   +G P+WE +VQ+++S  +Q Y
Sbjct:   55 TRLQTPRCDFEFSDFPWPERDNSSFPSHEEILEYLRNYATHFDVLKFVKFNSRVVAIRHVGETTKLDV--KPGEYGALFTGHPVWEVAVQTDQSHDVQWY 152          
BLAST of GH720913 vs. TrEMBL
Match: Q8H7K7_ORYSJ (Dimethylaniline monooxygenase, putative, expressed OS=Oryza sativa subsp. japonica GN=OSJNBb0076N15.17 PE=4 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 8.185e-19
Identity = 47/103 (45.63%), Postives = 64/103 (62.14%), Query Frame = 1
Query:   25 TKLQSQTWNYEFSDFPWPKRESSDYPTYAEILEYLHTYAVHFDLFKYVKFNSKVVEIKFIGDKEGFDFGRLHRDSGNPLSGRPMWEFSVQSN---ESDTIQLY 324
            T+LQ+   +YEFSD  WP R+   +PT+ EI++YL  YA  F L++Y+   SKVV +KF+G      F  L   SG PL G+PMWE +V S    +SD +QLY
Sbjct:   69 TRLQTPRPDYEFSDMAWPNRDDPSFPTHVEIVDYLEDYADRFGLWRYIALRSKVVGVKFLGGPSA-GFTELWSGSGEPLQGKPMWELAVSSTDDPDSDDVQLY 170          
BLAST of GH720913 vs. TrEMBL
Match: C5WVS1_SORBI (Putative uncharacterized protein Sb01g045120 OS=Sorghum bicolor GN=Sb01g045120 PE=4 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 8.185e-19
Identity = 47/100 (47.00%), Postives = 64/100 (64.00%), Query Frame = 1
Query:   25 TKLQSQTWNYEFSDFPWPKRESSDYPTYAEILEYLHTYAVHFDLFKYVKFNSKVVEIKFIGDKEGFDFGRLHRDSGNPLSGRPMWEFSVQSNESDTIQLY 324
            T+LQ+   +YEFSD+ W  R+   +PT+AEI+EYL  YA  F L++Y+ F +KVV+IKF+G   GF         G PL G+PMWE  V +  SDT+Q Y
Sbjct:   63 TRLQTPRPDYEFSDYSWRNRDDPTFPTHAEIIEYLEGYADTFGLWRYIMFGAKVVDIKFLGGGGGFT-ELWSGTGGEPLQGKPMWEVGVATAGSDTVQYY 161          
BLAST of GH720913 vs. TrEMBL
Match: B8APP0_ORYSI (Putative uncharacterized protein OS=Oryza sativa subsp. indica GN=OsI_10269 PE=4 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 8.185e-19
Identity = 47/103 (45.63%), Postives = 64/103 (62.14%), Query Frame = 1
Query:   25 TKLQSQTWNYEFSDFPWPKRESSDYPTYAEILEYLHTYAVHFDLFKYVKFNSKVVEIKFIGDKEGFDFGRLHRDSGNPLSGRPMWEFSVQSN---ESDTIQLY 324
            T+LQ+   +YEFSD  WP R+   +PT+ EI++YL  YA  F L++Y+   SKVV +KF+G      F  L   SG PL G+PMWE +V S    +SD +QLY
Sbjct:   69 TRLQTPRPDYEFSDMAWPNRDDPSFPTHVEIVDYLEDYADRFGLWRYIALRSKVVGVKFLGGPSA-GFTELWSGSGEPLQGKPMWELAVSSTDDPDSDDVQLY 170          
BLAST of GH720913 vs. SwissProt
Match: FMO1_ARATH (Probable flavin-containing monooxygenase 1 OS=Arabidopsis thaliana GN=FMO1 PE=2 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 1.119e-22
Identity = 54/102 (52.94%), Postives = 69/102 (67.65%), Query Frame = 1
Query:   25 TKLQSQTWNYEFSDFPWPK-RESSDYPTYAEILEYLHTYAVHFDLFKYVKFNSKVVEIKFIGDKEG---FDFGRLHRDSGNPLSGRPMWEFSVQSNESDTIQ 318
            TKLQS   +YEFSDFPWP  R+ + +P Y EIL+YL +YA HFDL K++KF SKV+E++FIGD E     D G      GN L G+P+WE +VQ  +S  IQ
Sbjct:   55 TKLQSARVDYEFSDFPWPNNRDDTTFPPYLEILDYLESYAKHFDLLKFMKFGSKVIEVRFIGDGETPQMVDLGAY----GNLLPGKPVWEVAVQIGDSGDIQ 152          
BLAST of GH720913 vs. SwissProt
Match: FMO2_ARATH (Putative flavin-containing monooxygenase 2 OS=Arabidopsis thaliana GN=FMO2 PE=3 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 1.462e-22
Identity = 49/95 (51.58%), Postives = 65/95 (68.42%), Query Frame = 1
Query:   25 TKLQSQTWNYEFSDFPWPKRESSDYPTYAEILEYLHTYAVHFDLFKYVKFNSKVVEIKFIGDKEGFDFGRLHRDSGNPLSGRPMWEFSVQSNESD 309
            TKLQS   +YE SDF WP R  S +PTY ++L+YL  YA HF+L K++KFNSKVVE++FIGD +    G L    GN L G+P+WE +V + + D
Sbjct:   49 TKLQSVRVSYELSDFLWPNRGESSFPTYVDVLDYLEAYAKHFNLVKFIKFNSKVVELRFIGDGKTLQMGDLGA-YGNLLPGKPVWEVAVNTGDGD 142          
BLAST of GH720913 vs. TAIR peptide
Match: AT1G19250.1 (| Symbols: FMO1 | flavin-dependent monooxygenase 1 | chr1:6650656-6653053 REVERSE LENGTH=530)

HSP 1 Score: 105.145 bits (261), Expect = 8.892e-24
Identity = 54/102 (52.94%), Postives = 69/102 (67.65%), Query Frame = 1
Query:   25 TKLQSQTWNYEFSDFPWPK-RESSDYPTYAEILEYLHTYAVHFDLFKYVKFNSKVVEIKFIGDKEG---FDFGRLHRDSGNPLSGRPMWEFSVQSNESDTIQ 318
            TKLQS   +YEFSDFPWP  R+ + +P Y EIL+YL +YA HFDL K++KF SKV+E++FIGD E     D G      GN L G+P+WE +VQ  +S  IQ
Sbjct:   55 TKLQSARVDYEFSDFPWPNNRDDTTFPPYLEILDYLESYAKHFDLLKFMKFGSKVIEVRFIGDGETPQMVDLGAY----GNLLPGKPVWEVAVQIGDSGDIQ 152          
BLAST of GH720913 vs. TAIR peptide
Match: AT5G45180.1 (| Symbols: | Flavin-binding monooxygenase family protein | chr5:18274179-18276586 REVERSE LENGTH=459)

HSP 1 Score: 104.76 bits (260), Expect = 1.161e-23
Identity = 49/95 (51.58%), Postives = 65/95 (68.42%), Query Frame = 1
Query:   25 TKLQSQTWNYEFSDFPWPKRESSDYPTYAEILEYLHTYAVHFDLFKYVKFNSKVVEIKFIGDKEGFDFGRLHRDSGNPLSGRPMWEFSVQSNESD 309
            TKLQS   +YE SDF WP R  S +PTY ++L+YL  YA HF+L K++KFNSKVVE++FIGD +    G L    GN L G+P+WE +V + + D
Sbjct:   55 TKLQSVRVSYELSDFLWPNRGESSFPTYVDVLDYLEAYAKHFNLVKFIKFNSKVVELRFIGDGKTLQMGDLGA-YGNLLPGKPVWEVAVNTGDGD 148          
The following BLAST results are available for this feature:
BLAST of GH720913 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
D7STZ9_VITVI8.166e-2754.37Whole genome shotgun sequence of line PN40024, sca... [more]
B9RR56_RICCO1.393e-2654.00Dimethylaniline monooxygenase, putative OS=Ricinus... [more]
B9MT30_POPTR1.540e-2553.92Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
B9GJB0_POPTR1.703e-2448.00Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
B9NF17_POPTR6.471e-2447.96Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
D7KHB6_ARALY1.033e-2151.96Flavin-dependent monooxygenase 1 OS=Arabidopsis ly... [more]
B9RR00_RICCO1.142e-2046.00Dimethylaniline monooxygenase, putative OS=Ricinus... [more]
Q8H7K7_ORYSJ8.185e-1945.63Dimethylaniline monooxygenase, putative, expressed... [more]
C5WVS1_SORBI8.185e-1947.00Putative uncharacterized protein Sb01g045120 OS=So... [more]
B8APP0_ORYSI8.185e-1945.63Putative uncharacterized protein OS=Oryza sativa s... [more]
back to top
BLAST of GH720913 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Swissprot)
Total hits: 2
Match NameE-valueIdentityDescription
FMO1_ARATH1.119e-2252.94Probable flavin-containing monooxygenase 1 OS=Arab... [more]
FMO2_ARATH1.462e-2251.58Putative flavin-containing monooxygenase 2 OS=Arab... [more]
back to top
BLAST of GH720913 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide)
Total hits: 2
Match NameE-valueIdentityDescription
AT1G19250.18.892e-2452.94| Symbols: FMO1 | flavin-dependent monooxygenase 1... [more]
AT5G45180.11.161e-2351.58| Symbols: | Flavin-binding monooxygenase family ... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020946Flavin-containing monooxygenase-likePFAMPF00743FMO-likecoord: 20..70
score: 1.1
NoneNo IPR availableGENE3D3.50.50.60no descriptioncoord: 15..71
score: 2.4
NoneNo IPR availablePANTHERPTHR23023DIMETHYLANILINE MONOOXYGENASEcoord: 18..70
score: 1.5
NoneNo IPR availablePANTHERPTHR23023:SF4DIMETHYLANILINE MONOOXYGENASE (FLAVIN-CONTAINING MONOOXYGENASE)coord: 18..70
score: 1.5

Properties
Property NameValue
Singlet in analysisPisum sativum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>GH720913 ID=GH720913|Name=GH720913|organism=Pisum sativum|type=EST|length=341bp
TTCGAGCGGCCGCCCNGGGCAGGTACTAAGCTTCAATCACAAACATGGAA
CTATGAGTTCAGTGATTTCCCTTGGCCTAAGAGAGAGAGTTCTGATTACC
CTACCTATGCTGAGATTTTGGAATACTTGCATACTTATGCAGTTCATTTT
GATTTGTTTAAGTATGTTAAGTTCAATTCCAAAGTCGTGGAAATCAAATT
TATTGGTGATAAAGAAGGTTTTGATTTCGGACGACTACATCGTGACAGTG
GAAATCCACTTTCTGGTCGTCCTATGTGGGAGTTCTCTGTTCAGAGTAAT
GAATCAGACACGATTCAGCTGTACCTCGGCCGCGACCACGC
back to top
Annotated Terms
The following terms have been associated with this EST:
Vocabulary: Molecular Function
TermDefinition
GO:0004499N,N-dimethylaniline monooxygenase activity
GO:0050660flavin adenine dinucleotide binding
GO:0050661NADP binding
Vocabulary: Biological Process
TermDefinition
GO:0055114oxidation-reduction process
Vocabulary: INTERPRO
TermDefinition
IPR020946Flavin_mOase-like