U74093

EST Overview
NameU74093
Unique NameU74093
TypeEST
OrganismPisum sativum (pea)
Sequence length272
Libraries
Library NameType
LIBEST_000542 Pisum sativum (J.S.Day)cdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Pisum sativum unigene v2Pisum sativum unigene v2EST
Pisum sativum unigene v1Pisum sativum unigene v1EST
Homology
BLAST of U74093 vs. TrEMBL
Match: Q1RU49_MEDTR (Putative polyprotein, related OS=Medicago truncatula GN=MtrDRAFT_AC153125g49v2 PE=4 SV=2)

HSP 1 Score: 120.939 bits (302), Expect = 3.989e-26
Identity = 54/71 (76.06%), Postives = 65/71 (91.55%), Query Frame = 3
Query:    3 VSEPEEKEDETIAETRESQKWDNDDYICMGHILNGMCDSLFDIYQSSNSAKELWEKLESRYMQEAATSKKF 215
            ++ PEEK+DET+AETR+ QKWDNDDYIC+ HILNGM DSLFDIYQSS SAK+LW+KLE+RYM+E ATSKK+
Sbjct:   45 MARPEEKDDETVAETRDRQKWDNDDYICLRHILNGMSDSLFDIYQSSPSAKDLWDKLETRYMREDATSKKW 115          
BLAST of U74093 vs. TrEMBL
Match: B2BXI0_ARALY (Gag-pol polymerase (Fragment) OS=Arabidopsis lyrata subsp. lyrata GN=GagPol1 PE=4 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 8.056e-19
Identity = 49/88 (55.68%), Postives = 62/88 (70.45%), Query Frame = 3
Query:    6 SEPEEKEDETIAETRESQKWDNDDYICMGHILNGMCDSLFDIYQSSNSAKELWEKLESRYMQEAATSKKFLVSQF--NNYKMIDGISV 263
            S+    E+E++ ETR+  KW+NDDYIC GHILNGM DSLFD+YQ+  SAKELW+ LES+YM E A+      SQF  +N  M + ISV
Sbjct:   21 SDTNNGENESVEETRKQLKWENDDYICRGHILNGMSDSLFDVYQNVESAKELWDALESKYMAEDAS------SQFAQHNMNMDESISV 102          
BLAST of U74093 vs. TrEMBL
Match: B9S5D0_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1568800 PE=4 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 3.742e-16
Identity = 41/66 (62.12%), Postives = 51/66 (77.27%), Query Frame = 3
Query:    9 EPEEKEDETIAETRESQKWDNDDYICMGHILNGMCDSLFDIYQSSNSAKELWEKLESRYMQEAATS 206
            +P E E+ET+A+TRE QKW+ +D I  GHILN M DSLFD+Y S  +AKELW+KLE +YMQE  TS
Sbjct:   19 KPVETENETLADTRERQKWETNDEIFRGHILNPMSDSLFDVYHSIPTAKELWDKLEIKYMQEDDTS 84          
BLAST of U74093 vs. TrEMBL
Match: A5BUY2_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_025981 PE=4 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 7.058e-15
Identity = 35/80 (43.75%), Postives = 56/80 (70.00%), Query Frame = 3
Query:   12 PEEKEDETIAETRESQKWDNDDYICMGHILNGMCDSLFDIYQSSNSAKELWEKLESRYMQEAATSKKFLVSQFNNYKMID 251
            PE KE++T       +K + D+ IC GHILN + D L+D+Y ++NSA+E+WE LE++Y  E   +K+FL+SQ+ ++K +D
Sbjct:   52 PEPKENDTPQVVAARKKREKDELICRGHILNALSDRLYDLYTNTNSAREIWEALENKYKAEEEGTKRFLISQYIDFKFVD 131          
BLAST of U74093 vs. TrEMBL
Match: A5B5H6_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_032507 PE=4 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 7.058e-15
Identity = 36/80 (45.00%), Postives = 55/80 (68.75%), Query Frame = 3
Query:   12 PEEKEDETIAETRESQKWDNDDYICMGHILNGMCDSLFDIYQSSNSAKELWEKLESRYMQEAATSKKFLVSQFNNYKMID 251
            PE KE++T       +K + D+ IC GHILN + D L+D+Y ++NSA+E+WE LE++Y  E   +KKFL+SQ+ ++K  D
Sbjct:   52 PEPKENDTPQVVAARKKREEDELICRGHILNALSDRLYDLYTNTNSAREIWEALENKYKAEEEGTKKFLISQYIDFKFFD 131          
BLAST of U74093 vs. TrEMBL
Match: A5ANU6_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_013138 PE=4 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 7.058e-15
Identity = 36/80 (45.00%), Postives = 55/80 (68.75%), Query Frame = 3
Query:   12 PEEKEDETIAETRESQKWDNDDYICMGHILNGMCDSLFDIYQSSNSAKELWEKLESRYMQEAATSKKFLVSQFNNYKMID 251
            PE KE++T       +K + D+ IC GHILN + D L+D+Y ++NSA+E+WE LE++Y  E   +KKFL+SQ+ ++K  D
Sbjct:   52 PEPKENDTPQVVAARKKREEDELICRGHILNALSDRLYDLYTNTNSAREIWEALENKYKAEEEGTKKFLISQYIDFKFFD 131          
BLAST of U74093 vs. TrEMBL
Match: A5ALT9_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_021427 PE=4 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 4.575e-14
Identity = 35/80 (43.75%), Postives = 54/80 (67.50%), Query Frame = 3
Query:   12 PEEKEDETIAETRESQKWDNDDYICMGHILNGMCDSLFDIYQSSNSAKELWEKLESRYMQEAATSKKFLVSQFNNYKMID 251
            PE KE++T       +K + D+ IC GHILN + D L+D+Y ++ SA+E+WE LE++Y  E   +KKFL+SQ+ ++K  D
Sbjct:   52 PEPKENDTPQVVAARKKREEDELICRGHILNALSDRLYDLYTNTXSAREIWEALENKYKAEEEGTKKFLISQYIDFKFFD 131          
BLAST of U74093 vs. TrEMBL
Match: A5AEN5_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_011340 PE=4 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.019e-13
Identity = 35/86 (40.70%), Postives = 56/86 (65.12%), Query Frame = 3
Query:   12 PEEKEDE-TIAETRESQKWDNDDYICMGHILNGMCDSLFDIYQSSNSAKELWEKLESRYMQEAATSKKFLVSQFNNYKMIDGISVL 266
            P+ KEDE  I        W + D++C  +++NG+ DSL+++Y    +AKELWE L+ +Y  E A +KKF+V +F +YKM+D  +V+
Sbjct:   74 PKLKEDEHDIQVISAIDAWKHSDFLCRNYVMNGLADSLYNVYSDKKTAKELWESLDRKYKTEDAGAKKFVVGRFLDYKMVDSKTVV 159          
BLAST of U74093 vs. TrEMBL
Match: A5AMN2_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_003451 PE=4 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 1.331e-13
Identity = 35/86 (40.70%), Postives = 56/86 (65.12%), Query Frame = 3
Query:   12 PEEKEDE-TIAETRESQKWDNDDYICMGHILNGMCDSLFDIYQSSNSAKELWEKLESRYMQEAATSKKFLVSQFNNYKMIDGISVL 266
            P+ KEDE  I        W + D++C  +++NG+ DSL+++Y    +AKELWE L+ +Y  E A +KKF+V +F +YKM+D  +V+
Sbjct:   74 PKLKEDEHDIQVISAIDAWKHSDFLCRNYVMNGLTDSLYNVYSDKKTAKELWESLDRKYKTEDAGAKKFVVGRFLDYKMVDSKTVV 159          
BLAST of U74093 vs. TrEMBL
Match: A5BPP9_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_008235 PE=4 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 1.738e-13
Identity = 34/77 (44.16%), Postives = 53/77 (68.83%), Query Frame = 3
Query:   12 PEEKEDETIAETRESQKWDNDDYICMGHILNGMCDSLFDIYQSSNSAKELWEKLESRYMQEAATSKKFLVSQFNNYK 242
            PE KE++T       +K + D+ IC GHILN + D L+D+Y ++ SA+E+WE LE++Y  E   +KKFL+SQ+ ++K
Sbjct:   52 PEPKENDTPQVVATRKKMEEDELICRGHILNALSDRLYDLYTNTYSAREIWEALENKYKAEEEGTKKFLISQYIDFK 128          
BLAST of U74093 vs. TAIR peptide
Match: AT4G00980.1 (| Symbols: | zinc knuckle (CCHC-type) family protein | chr4:422732-424580 REVERSE LENGTH=488)

HSP 1 Score: 57.3806 bits (137), Expect = 2.117e-9
Identity = 28/87 (32.18%), Postives = 47/87 (54.02%), Query Frame = 3
Query:   12 PEEKEDETIAETRESQKWDNDDYICMGHILNGMCDSLFDIY-QSSNSAKELWEKLESRYMQEAATSKKFLVSQFNNYKMIDGISVLE 269
            PE    E        +KW  DDY+C  H++N + D L+  Y Q    AKELW++L+  Y  + + SK+  V ++  ++M++   +LE
Sbjct:  236 PETNPREITRADATGKKWLRDDYLCYTHLMNSLSDHLYRRYSQKFKHAKELWDELKWVYQCDESKSKRSQVRKYIEFRMVEERPILE 322          
BLAST of U74093 vs. TAIR peptide
Match: AT4G00980.1 (| Symbols: | zinc knuckle (CCHC-type) family protein | chr4:422732-424580 REVERSE LENGTH=488)

HSP 1 Score: 57.3806 bits (137), Expect = 2.117e-9
Identity = 28/87 (32.18%), Postives = 47/87 (54.02%), Query Frame = 3
Query:   12 PEEKEDETIAETRESQKWDNDDYICMGHILNGMCDSLFDIY-QSSNSAKELWEKLESRYMQEAATSKKFLVSQFNNYKMIDGISVLE 269
            PE    E        +KW  DDY+C  H++N + D L+  Y Q    AKELW++L+  Y  + + SK+  V ++  ++M++   +LE
Sbjct:  236 PETNPREITRADATGKKWLRDDYLCYTHLMNSLSDHLYRRYSQKFKHAKELWDELKWVYQCDESKSKRSQVRKYIEFRMVEERPILE 322          
BLAST of U74093 vs. TrEMBL
Match: Q1RU49_MEDTR (Putative polyprotein, related OS=Medicago truncatula GN=MtrDRAFT_AC153125g49v2 PE=4 SV=2)

HSP 1 Score: 120.939 bits (302), Expect = 4.988e-26
Identity = 54/71 (76.06%), Postives = 65/71 (91.55%), Query Frame = 3
Query:    3 VSEPEEKEDETIAETRESQKWDNDDYICMGHILNGMCDSLFDIYQSSNSAKELWEKLESRYMQEAATSKKF 215
            ++ PEEK+DET+AETR+ QKWDNDDYIC+ HILNGM DSLFDIYQSS SAK+LW+KLE+RYM+E ATSKK+
Sbjct:   45 MARPEEKDDETVAETRDRQKWDNDDYICLRHILNGMSDSLFDIYQSSPSAKDLWDKLETRYMREDATSKKW 115          
BLAST of U74093 vs. TrEMBL
Match: B2BXI0_ARALY (Gag-pol polymerase (Fragment) OS=Arabidopsis lyrata subsp. lyrata GN=GagPol1 PE=4 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.007e-18
Identity = 49/88 (55.68%), Postives = 62/88 (70.45%), Query Frame = 3
Query:    6 SEPEEKEDETIAETRESQKWDNDDYICMGHILNGMCDSLFDIYQSSNSAKELWEKLESRYMQEAATSKKFLVSQF--NNYKMIDGISV 263
            S+    E+E++ ETR+  KW+NDDYIC GHILNGM DSLFD+YQ+  SAKELW+ LES+YM E A+      SQF  +N  M + ISV
Sbjct:   21 SDTNNGENESVEETRKQLKWENDDYICRGHILNGMSDSLFDVYQNVESAKELWDALESKYMAEDAS------SQFAQHNMNMDESISV 102          
BLAST of U74093 vs. TrEMBL
Match: B9S5D0_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1568800 PE=4 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 4.680e-16
Identity = 41/66 (62.12%), Postives = 51/66 (77.27%), Query Frame = 3
Query:    9 EPEEKEDETIAETRESQKWDNDDYICMGHILNGMCDSLFDIYQSSNSAKELWEKLESRYMQEAATS 206
            +P E E+ET+A+TRE QKW+ +D I  GHILN M DSLFD+Y S  +AKELW+KLE +YMQE  TS
Sbjct:   19 KPVETENETLADTRERQKWETNDEIFRGHILNPMSDSLFDVYHSIPTAKELWDKLEIKYMQEDDTS 84          
BLAST of U74093 vs. TrEMBL
Match: A5BUY2_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_025981 PE=4 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 8.826e-15
Identity = 35/80 (43.75%), Postives = 56/80 (70.00%), Query Frame = 3
Query:   12 PEEKEDETIAETRESQKWDNDDYICMGHILNGMCDSLFDIYQSSNSAKELWEKLESRYMQEAATSKKFLVSQFNNYKMID 251
            PE KE++T       +K + D+ IC GHILN + D L+D+Y ++NSA+E+WE LE++Y  E   +K+FL+SQ+ ++K +D
Sbjct:   52 PEPKENDTPQVVAARKKREKDELICRGHILNALSDRLYDLYTNTNSAREIWEALENKYKAEEEGTKRFLISQYIDFKFVD 131          
BLAST of U74093 vs. TrEMBL
Match: A5B5H6_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_032507 PE=4 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 8.826e-15
Identity = 36/80 (45.00%), Postives = 55/80 (68.75%), Query Frame = 3
Query:   12 PEEKEDETIAETRESQKWDNDDYICMGHILNGMCDSLFDIYQSSNSAKELWEKLESRYMQEAATSKKFLVSQFNNYKMID 251
            PE KE++T       +K + D+ IC GHILN + D L+D+Y ++NSA+E+WE LE++Y  E   +KKFL+SQ+ ++K  D
Sbjct:   52 PEPKENDTPQVVAARKKREEDELICRGHILNALSDRLYDLYTNTNSAREIWEALENKYKAEEEGTKKFLISQYIDFKFFD 131          
BLAST of U74093 vs. TrEMBL
Match: A5ANU6_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_013138 PE=4 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 8.826e-15
Identity = 36/80 (45.00%), Postives = 55/80 (68.75%), Query Frame = 3
Query:   12 PEEKEDETIAETRESQKWDNDDYICMGHILNGMCDSLFDIYQSSNSAKELWEKLESRYMQEAATSKKFLVSQFNNYKMID 251
            PE KE++T       +K + D+ IC GHILN + D L+D+Y ++NSA+E+WE LE++Y  E   +KKFL+SQ+ ++K  D
Sbjct:   52 PEPKENDTPQVVAARKKREEDELICRGHILNALSDRLYDLYTNTNSAREIWEALENKYKAEEEGTKKFLISQYIDFKFFD 131          
BLAST of U74093 vs. TrEMBL
Match: A5ALT9_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_021427 PE=4 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 5.721e-14
Identity = 35/80 (43.75%), Postives = 54/80 (67.50%), Query Frame = 3
Query:   12 PEEKEDETIAETRESQKWDNDDYICMGHILNGMCDSLFDIYQSSNSAKELWEKLESRYMQEAATSKKFLVSQFNNYKMID 251
            PE KE++T       +K + D+ IC GHILN + D L+D+Y ++ SA+E+WE LE++Y  E   +KKFL+SQ+ ++K  D
Sbjct:   52 PEPKENDTPQVVAARKKREEDELICRGHILNALSDRLYDLYTNTXSAREIWEALENKYKAEEEGTKKFLISQYIDFKFFD 131          
BLAST of U74093 vs. TrEMBL
Match: A5AEN5_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_011340 PE=4 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.274e-13
Identity = 35/86 (40.70%), Postives = 56/86 (65.12%), Query Frame = 3
Query:   12 PEEKEDE-TIAETRESQKWDNDDYICMGHILNGMCDSLFDIYQSSNSAKELWEKLESRYMQEAATSKKFLVSQFNNYKMIDGISVL 266
            P+ KEDE  I        W + D++C  +++NG+ DSL+++Y    +AKELWE L+ +Y  E A +KKF+V +F +YKM+D  +V+
Sbjct:   74 PKLKEDEHDIQVISAIDAWKHSDFLCRNYVMNGLADSLYNVYSDKKTAKELWESLDRKYKTEDAGAKKFVVGRFLDYKMVDSKTVV 159          
BLAST of U74093 vs. TrEMBL
Match: A5AMN2_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_003451 PE=4 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 1.664e-13
Identity = 35/86 (40.70%), Postives = 56/86 (65.12%), Query Frame = 3
Query:   12 PEEKEDE-TIAETRESQKWDNDDYICMGHILNGMCDSLFDIYQSSNSAKELWEKLESRYMQEAATSKKFLVSQFNNYKMIDGISVL 266
            P+ KEDE  I        W + D++C  +++NG+ DSL+++Y    +AKELWE L+ +Y  E A +KKF+V +F +YKM+D  +V+
Sbjct:   74 PKLKEDEHDIQVISAIDAWKHSDFLCRNYVMNGLTDSLYNVYSDKKTAKELWESLDRKYKTEDAGAKKFVVGRFLDYKMVDSKTVV 159          
BLAST of U74093 vs. TrEMBL
Match: A5BPP9_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_008235 PE=4 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.174e-13
Identity = 34/77 (44.16%), Postives = 53/77 (68.83%), Query Frame = 3
Query:   12 PEEKEDETIAETRESQKWDNDDYICMGHILNGMCDSLFDIYQSSNSAKELWEKLESRYMQEAATSKKFLVSQFNNYK 242
            PE KE++T       +K + D+ IC GHILN + D L+D+Y ++ SA+E+WE LE++Y  E   +KKFL+SQ+ ++K
Sbjct:   52 PEPKENDTPQVVATRKKMEEDELICRGHILNALSDRLYDLYTNTYSAREIWEALENKYKAEEEGTKKFLISQYIDFK 128          
BLAST of U74093 vs. Lotus protein
Match: LjSGA_012609.1 (- phase: 0 /partial)

HSP 1 Score: 49.2914 bits (116), Expect = 3.912e-7
Identity = 20/64 (31.25%), Postives = 39/64 (60.94%), Query Frame = 3
Query:    3 VSEPEEKEDETIAETRESQKWDNDDYICMGHILNGMCDSLFDIYQSSNSAKELWEKLESRYMQE 194
            + EP++ + + +   R+ ++   D+ +C GHILN + D L+D+Y  +  A E+W+ LE ++  E
Sbjct:   10 IVEPQDDDSDELKIERKKRR--EDELLCRGHILNTLSDRLYDLYTDTQFAVEIWKALEFKFKAE 71          
BLAST of U74093 vs. Soybean peptides
Match: Glyma10g12900.1|PACid:16279383 ()

HSP 1 Score: 120.939 bits (302), Expect = 2.442e-28
Identity = 57/86 (66.28%), Postives = 66/86 (76.74%), Query Frame = 3
Query:   12 PEEKEDETIAETRESQKWDNDDYICMGHILNGMCDSLFDIYQSSNSAKELWEKLESRYMQEAATSKKFLVSQFNNYKMIDGISVLE 269
            P   EDET+ +TR+  KW+NDDYIC GHILNGM DSLFDIYQ+  SAKELW+ LES+YM E A+  KFLVS F NYKMID   V+E
Sbjct:   48 PVFMEDETLDQTRKRSKWENDDYICRGHILNGMSDSLFDIYQNVESAKELWDSLESKYMAEDASRNKFLVSNFFNYKMIDSRPVME 133          
BLAST of U74093 vs. Soybean peptides
Match: Glyma01g27480.1|PACid:16244589 ()

HSP 1 Score: 86.2705 bits (212), Expect = 6.666e-18
Identity = 37/52 (71.15%), Postives = 44/52 (84.62%), Query Frame = 3
Query:   24 EDETIAETRESQKWDNDDYICMGHILNGMCDSLFDIYQSSNSAKELWEKLES 179
            EDET+ +T++  KW+NDDYIC GHILNGM DSLFDIYQ+  SAKELW+ LES
Sbjct:  283 EDETLDQTKKRSKWENDDYICRGHILNGMSDSLFDIYQNVESAKELWDSLES 334          
BLAST of U74093 vs. Soybean peptides
Match: Glyma02g15950.1|PACid:16248227 ()

HSP 1 Score: 83.5741 bits (205), Expect = 4.321e-17
Identity = 38/51 (74.51%), Postives = 43/51 (84.31%), Query Frame = 3
Query:   66 DNDDYICMGHILNGMCDSLFDIYQSSNSAKELWEKLESRYMQEAATSKKFL 218
            +NDDYIC GHILNGM DSLFDIYQ+  SAKELW+ LES+YM E A+S KFL
Sbjct:  225 ENDDYICRGHILNGMYDSLFDIYQNVESAKELWDSLESKYMAEDASSNKFL 275          
BLAST of U74093 vs. Soybean peptides
Match: Glyma1309s00200.1|PACid:16289177 ()

HSP 1 Score: 62.7734 bits (151), Expect = 7.892e-11
Identity = 30/67 (44.78%), Postives = 43/67 (64.18%), Query Frame = 3
Query:   63 WDNDDYICMGHILNGMCDSLFDIYQSSNSAKELWEKLESRYMQEAATSKKFLVSQFNNYKMIDGISV 263
            W+ +DY+C   ILNG+ D L+D Y    SAK +W  LE +Y  E A +KK++VS++  Y+M D  SV
Sbjct:   43 WNENDYLCKNFILNGLADDLYD-YSPYKSAKLVWLALEEKYDIEEARTKKYVVSRYLKYQMTDDKSV 108          
BLAST of U74093 vs. Soybean peptides
Match: Glyma19g44550.1|PACid:16314935 ()

HSP 1 Score: 56.6102 bits (135), Expect = 5.656e-9
Identity = 29/90 (32.22%), Postives = 56/90 (62.22%), Query Frame = 3
Query:    3 VSEPEEKEDETIAETRESQKWDNDDYICMGHILNGMCDSLFDIYQSSN-SAKELWEKLESRYMQEAATSKKFLVSQFNNYKMIDGISVLE 269
            + E  + ED   A+  E ++W NDD  C  +IL+ + D L+++Y +   SAK+LWE+L+  Y+ E   +K++ V ++  ++M++  +V+E
Sbjct:  235 LGESAKAEDIATAKAAE-RRWLNDDLTCHRNILSHLSDPLYNLYANRKLSAKDLWEELKLVYLYEEFGTKRYHVKKYLEFQMVEEKAVIE 323          
BLAST of U74093 vs. Soybean peptides
Match: Glyma03g41890.1|PACid:16254191 ()

HSP 1 Score: 55.4546 bits (132), Expect = 1.260e-8
Identity = 28/82 (34.15%), Postives = 53/82 (64.63%), Query Frame = 3
Query:   30 ETIAETRESQK-WDNDDYICMGHILNGMCDSLFDIYQSSN-SAKELWEKLESRYMQEAATSKKFLVSQFNNYKMIDGISVLE 269
            E IA T+ +++ W NDD  C  +IL+ + D L+++Y +   SAK+LWE+L+  Y+ E   +K+  V ++  ++M++  +V+E
Sbjct:  284 EDIAATKAAERRWLNDDLTCQRNILSHLSDPLYNLYANRKMSAKDLWEELKLVYLYEEFGTKRSQVKKYLEFQMVEEKAVIE 365          
BLAST of U74093 vs. Soybean peptides
Match: Glyma02g03270.1|PACid:16246823 ()

HSP 1 Score: 51.2174 bits (121), Expect = 2.376e-7
Identity = 26/72 (36.11%), Postives = 41/72 (56.94%), Query Frame = 3
Query:   12 PEEKEDETIAE-TRESQKWDNDDYICMGHILNGMCDSLFDIYQSSNSAKELWEKLESRYMQEAATSKKFLVS 224
            P++ E E   + T E    + +DY+C   ILNG+ D L+D Y    S K +W  L+ +Y  E A +KK++V+
Sbjct:   10 PKDVEKEVKDKMTMELALCNENDYLCKNFILNGLVDDLYDYYSPYKSVKLVWLALKKKYDTEEAETKKYVVA 81          
The following BLAST results are available for this feature:
BLAST of U74093 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
Q1RU49_MEDTR3.989e-2676.06Putative polyprotein, related OS=Medicago truncatu... [more]
B2BXI0_ARALY8.056e-1955.68Gag-pol polymerase (Fragment) OS=Arabidopsis lyrat... [more]
B9S5D0_RICCO3.742e-1662.12Putative uncharacterized protein OS=Ricinus commun... [more]
A5BUY2_VITVI7.058e-1543.75Putative uncharacterized protein OS=Vitis vinifera... [more]
A5B5H6_VITVI7.058e-1545.00Putative uncharacterized protein OS=Vitis vinifera... [more]
A5ANU6_VITVI7.058e-1545.00Putative uncharacterized protein OS=Vitis vinifera... [more]
A5ALT9_VITVI4.575e-1443.75Putative uncharacterized protein OS=Vitis vinifera... [more]
A5AEN5_VITVI1.019e-1340.70Putative uncharacterized protein OS=Vitis vinifera... [more]
A5AMN2_VITVI1.331e-1340.70Putative uncharacterized protein OS=Vitis vinifera... [more]
A5BPP9_VITVI1.738e-1344.16Putative uncharacterized protein OS=Vitis vinifera... [more]
back to top
BLAST of U74093 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide)
Total hits: 1
Match NameE-valueIdentityDescription
AT4G00980.12.117e-932.18| Symbols: | zinc knuckle (CCHC-type) family prot... [more]
back to top
BLAST of U74093 vs. TAIR peptide
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs TAIR 10 peptide)
Total hits: 1
Match NameE-valueIdentityDescription
AT4G00980.12.117e-932.18| Symbols: | zinc knuckle (CCHC-type) family prot... [more]
back to top
BLAST of U74093 vs. TrEMBL
Analysis Date: 2011-04-27 (Homology Analysis: Pisum sativum unigene v2 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
Q1RU49_MEDTR4.988e-2676.06Putative polyprotein, related OS=Medicago truncatu... [more]
B2BXI0_ARALY1.007e-1855.68Gag-pol polymerase (Fragment) OS=Arabidopsis lyrat... [more]
B9S5D0_RICCO4.680e-1662.12Putative uncharacterized protein OS=Ricinus commun... [more]
A5BUY2_VITVI8.826e-1543.75Putative uncharacterized protein OS=Vitis vinifera... [more]
A5B5H6_VITVI8.826e-1545.00Putative uncharacterized protein OS=Vitis vinifera... [more]
A5ANU6_VITVI8.826e-1545.00Putative uncharacterized protein OS=Vitis vinifera... [more]
A5ALT9_VITVI5.721e-1443.75Putative uncharacterized protein OS=Vitis vinifera... [more]
A5AEN5_VITVI1.274e-1340.70Putative uncharacterized protein OS=Vitis vinifera... [more]
A5AMN2_VITVI1.664e-1340.70Putative uncharacterized protein OS=Vitis vinifera... [more]
A5BPP9_VITVI2.174e-1344.16Putative uncharacterized protein OS=Vitis vinifera... [more]
back to top
BLAST of U74093 vs. Lotus protein
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Lotus proteins)
Total hits: 1
Match NameE-valueIdentityDescription
LjSGA_012609.13.912e-731.25- phase: 0 /partial[more]
back to top
BLAST of U74093 vs. Soybean peptides
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Soybean peptides)
Total hits: 7
Match NameE-valueIdentityDescription
Glyma10g12900.1|PACid:162793832.442e-2866.28[more]
Glyma01g27480.1|PACid:162445896.666e-1871.15[more]
Glyma02g15950.1|PACid:162482274.321e-1774.51[more]
Glyma1309s00200.1|PACid:162891777.892e-1144.78[more]
Glyma19g44550.1|PACid:163149355.656e-932.22[more]
Glyma03g41890.1|PACid:162541911.260e-834.15[more]
Glyma02g03270.1|PACid:162468232.376e-736.11[more]
back to top
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v2
Date Performed: 2011-04-27
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSEGsegsegcoord: 6..16
score
NoneNo IPR availableSEGsegsegcoord: 37..50
score

Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSEGsegsegcoord: 6..16
score
NoneNo IPR availableSEGsegsegcoord: 37..50
score

Properties
Property NameValue
Singlet in analysisPisum sativum unigene v2
Singlet in analysisPisum sativum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>U74093 ID=U74093|Name=U74093|organism=Pisum sativum|type=EST|length=272bp
TGGTTTCAGAACCGGAAGAAAAAGAAGATGAAACAATTGCTGAAACTAGA
GAGAGCCAAAAGTGGGACAATGATGATTATATATGCATGGGACACATCCT
CAACGGTATGTGCGATTCGTTGTTCGACATTTATCAGAGCAGTAACTCCG
CAAAAGAGTTATGGGAAAAATTGGAATCAAGATACATGCAAGAGGCCGCT
ACAAGTAAGAAGTTTCTTGTTTCTCAATTTAATAACTATAAAATGATAGA
TGGTATCTCTGTTCTGGAACCA
back to top