AJ308170

EST Overview
NameAJ308170
Unique NameAJ308170
TypeEST
OrganismPisum sativum (pea)
Sequence length321
Libraries
Library NameType
LIBEST_009888 SSHcdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Pisum sativum unigene v1Pisum sativum unigene v1EST
Homology
BLAST of AJ308170 vs. TrEMBL
Match: B7FM13_MEDTR (Putative uncharacterized protein OS=Medicago truncatula PE=2 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 4.149e-39
Identity = 78/91 (85.71%), Postives = 84/91 (92.31%), Query Frame = 3
Query:    3 GFQFLQSYYPERLAKCYILHMPWFFVSVWRLVSGFLDKATQEKIVIISNEDERKEFINEVGEEILPEEYGGRAKLVAIQDFEVTPLENGRT 275
            GFQFLQSYYPE LAKCYILHMPWFFVSVWR VSGFLDKATQEKIVIISNE+E+K F++EVGE+ILPEEYGGRAKLV IQ+ EV P ENGRT
Sbjct:  158 GFQFLQSYYPECLAKCYILHMPWFFVSVWRFVSGFLDKATQEKIVIISNEEEKKLFVSEVGEDILPEEYGGRAKLVPIQEVEVRPPENGRT 248          
BLAST of AJ308170 vs. TrEMBL
Match: B9HJH3_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_656990 PE=4 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 4.158e-31
Identity = 63/87 (72.41%), Postives = 75/87 (86.21%), Query Frame = 3
Query:    3 GFQFLQSYYPERLAKCYILHMPWFFVSVWRLVSGFLDKATQEKIVIISNEDERKEFINEVGEEILPEEYGGRAKLVAIQDFEVTPLE 263
            GFQ LQ+YYPERLAKC+IL MPWFFVSVWR+VS FL+KAT EK+VI+++E+ER  F+ E+GEE+LPEEYGGRA LVA QD  V PLE
Sbjct:  157 GFQLLQAYYPERLAKCFILSMPWFFVSVWRMVSRFLEKATLEKVVIVTSEEERDFFVKEIGEEVLPEEYGGRAMLVAPQDVTVPPLE 243          
BLAST of AJ308170 vs. TrEMBL
Match: D7T8K2_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_11.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00011647001 PE=4 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 3.520e-30
Identity = 63/92 (68.48%), Postives = 79/92 (85.87%), Query Frame = 3
Query:    3 GFQFLQSYYPERLAKCYILHMPWFFVSVWRLVSGFLDKATQEKIVIISNEDERKEFINEVGEEILPEEYGGRAKLVAIQDFEVTPLENGRTN 278
            GFQFLQSYYPERLA+C+IL+MP FFVSVWR+VS FL+KAT EKIVI+SNE ER++FI E+GEE LPEEYGGR+ L+A+QD  ++ L   +T+
Sbjct:  156 GFQFLQSYYPERLARCFILNMPGFFVSVWRMVSYFLEKATLEKIVIVSNEAERRDFIKEIGEEALPEEYGGRSNLIALQDPPLSLLNPNQTS 247          
BLAST of AJ308170 vs. TrEMBL
Match: A2PZE8_IPONI (SEC14 cytosolic factor / phosphoglyceride transfer family protein OS=Ipomoea nil GN=In32 PE=2 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 1.747e-29
Identity = 60/86 (69.77%), Postives = 75/86 (87.21%), Query Frame = 3
Query:    3 GFQFLQSYYPERLAKCYILHMPWFFVSVWRLVSGFLDKATQEKIVIISNEDERKEFINEVGEEILPEEYGGRAKLVAIQDFEVTPL 260
            GFQFLQ+YYPERLAK Y+LHMP FFV+VW+LVS FL+KAT EKIVI+SNE+ER + + EVGE++LPEEYGG++K VA+QD  + PL
Sbjct:  157 GFQFLQAYYPERLAKFYLLHMPLFFVAVWKLVSRFLEKATLEKIVIVSNEEERLQLMREVGEDVLPEEYGGKSKFVAMQDVVINPL 242          
BLAST of AJ308170 vs. TrEMBL
Match: B9HVU4_POPTR (Predicted protein (Fragment) OS=Populus trichocarpa GN=POPTRDRAFT_231689 PE=4 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 8.671e-29
Identity = 58/83 (69.88%), Postives = 71/83 (85.54%), Query Frame = 3
Query:    3 GFQFLQSYYPERLAKCYILHMPWFFVSVWRLVSGFLDKATQEKIVIISNEDERKEFINEVGEEILPEEYGGRAKLVAIQDFEV 251
            GFQ LQSYYP+RLAKC+IL MPWFFVS WR++S FL+K T EKIVI++N++ERK F+ E+GEE+LPEE GGRA LVA+QD  V
Sbjct:  152 GFQLLQSYYPDRLAKCFILSMPWFFVSFWRMISRFLEKGTLEKIVIVTNDEERKCFVKEIGEEVLPEELGGRATLVALQDVTV 234          
BLAST of AJ308170 vs. TrEMBL
Match: D7KCK0_ARALY (F10B6.22 OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_312479 PE=4 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 2.523e-28
Identity = 60/80 (75.00%), Postives = 69/80 (86.25%), Query Frame = 3
Query:    3 GFQFLQSYYPERLAKCYILHMPWFFVSVWRLVSGFLDKATQEKIVIISNEDERKEFINEVGEEILPEEYGGRAKLVAIQD 242
            GFQFLQSYYPERLAKCYILHMP FFV+VW+ V  FL+KATQEKIVI+++ +E K+F  E+G E LPEEYGGRAKL AIQD
Sbjct:  204 GFQFLQSYYPERLAKCYILHMPGFFVTVWKFVCRFLEKATQEKIVIVTDGEELKKFEEEIGAEALPEEYGGRAKLTAIQD 283          
BLAST of AJ308170 vs. TrEMBL
Match: B9T4M6_RICCO (Aspartate semialdehyde dehydrogenase, putative OS=Ricinus communis GN=RCOM_0053560 PE=4 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 4.303e-28
Identity = 58/88 (65.91%), Postives = 74/88 (84.09%), Query Frame = 3
Query:    3 GFQFLQSYYPERLAKCYILHMPWFFVSVWRLVSGFLDKATQEKIVIISNEDERKEFINEVGEEILPEEYGGRAKLVAIQDFEVTPLEN 266
            GFQ LQ+YYPERLAK Y+LHMP FFVSVW+++S FL+KAT EK++I+SN++ER+  I E+GEEILP+EYGGR KLVA QD  +  LE+
Sbjct:  156 GFQCLQAYYPERLAKLYLLHMPRFFVSVWKMISRFLEKATLEKVMIVSNDEERRNLIKEIGEEILPDEYGGRTKLVAFQDALLPQLED 243          
BLAST of AJ308170 vs. TrEMBL
Match: Q9LQU9_ARATH (F10B6.22 OS=Arabidopsis thaliana PE=4 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 5.620e-28
Identity = 58/80 (72.50%), Postives = 70/80 (87.50%), Query Frame = 3
Query:    3 GFQFLQSYYPERLAKCYILHMPWFFVSVWRLVSGFLDKATQEKIVIISNEDERKEFINEVGEEILPEEYGGRAKLVAIQD 242
            GFQFLQSYYPERLAKCYILHMP FFV+VW+ V  FL+KATQEKIVI+++ +E+++F  E+G + LPEEYGGRAKL AIQD
Sbjct:  209 GFQFLQSYYPERLAKCYILHMPGFFVTVWKFVCRFLEKATQEKIVIVTDGEEQRKFEEEIGADALPEEYGGRAKLTAIQD 288          
BLAST of AJ308170 vs. TrEMBL
Match: Q8GXG8_ARATH (Putative phosphatidylinositol/ phosphatidylcholine transfer protein OS=Arabidopsis thaliana GN=At1g14820/F10B6_7 PE=2 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 5.620e-28
Identity = 58/80 (72.50%), Postives = 70/80 (87.50%), Query Frame = 3
Query:    3 GFQFLQSYYPERLAKCYILHMPWFFVSVWRLVSGFLDKATQEKIVIISNEDERKEFINEVGEEILPEEYGGRAKLVAIQD 242
            GFQFLQSYYPERLAKCYILHMP FFV+VW+ V  FL+KATQEKIVI+++ +E+++F  E+G + LPEEYGGRAKL AIQD
Sbjct:  144 GFQFLQSYYPERLAKCYILHMPGFFVTVWKFVCRFLEKATQEKIVIVTDGEEQRKFEEEIGADALPEEYGGRAKLTAIQD 223          
BLAST of AJ308170 vs. TrEMBL
Match: Q3EDC4_ARATH (AT1G14820 protein OS=Arabidopsis thaliana GN=AT1G14820 PE=2 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 5.620e-28
Identity = 58/80 (72.50%), Postives = 70/80 (87.50%), Query Frame = 3
Query:    3 GFQFLQSYYPERLAKCYILHMPWFFVSVWRLVSGFLDKATQEKIVIISNEDERKEFINEVGEEILPEEYGGRAKLVAIQD 242
            GFQFLQSYYPERLAKCYILHMP FFV+VW+ V  FL+KATQEKIVI+++ +E+++F  E+G + LPEEYGGRAKL AIQD
Sbjct:  157 GFQFLQSYYPERLAKCYILHMPGFFVTVWKFVCRFLEKATQEKIVIVTDGEEQRKFEEEIGADALPEEYGGRAKLTAIQD 236          
BLAST of AJ308170 vs. SwissProt
Match: YKJ1_YEAST (CRAL-TRIO domain-containing protein YKL091C OS=Saccharomyces cerevisiae GN=YKL091C PE=1 SV=2)

HSP 1 Score: 60.8474 bits (146), Expect = 2.396e-9
Identity = 29/70 (41.43%), Postives = 46/70 (65.71%), Query Frame = 3
Query:   18 QSYYPERLAKCYILHMPWFFVSVWRLVSGFLDKATQEKIVIISNEDERKEFINEVGEEILPEEYGGRAKL 227
            Q+YYPER+ K YI+H P+ F +++++V  FLD  T  KI I+ +   +KE + ++  E LP +YGG + L
Sbjct:  204 QNYYPERMGKFYIIHSPFGFSTMFKMVKPFLDPVTVSKIFILGS-SYKKELLKQIPIENLPVKYGGTSVL 272          
BLAST of AJ308170 vs. SwissProt
Match: SEC14_SCHPO (Sec14 cytosolic factor OS=Schizosaccharomyces pombe GN=sec14 PE=2 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 6.973e-9
Identity = 26/69 (37.68%), Postives = 44/69 (63.77%), Query Frame = 3
Query:   18 QSYYPERLAKCYILHMPWFFVSVWRLVSGFLDKATQEKIVIISNEDERKEFINEVGEEILPEEYGGRAK 224
            Q YYPER+ K Y+++ PW F S + L+ GFLD+AT +KI I+ + + +   + ++  + LP + GG  +
Sbjct:  197 QDYYPERMGKFYVINAPWGFSSAFNLIKGFLDEATVKKIHILGS-NYKSALLEQIPADNLPAKLGGNCQ 264          
BLAST of AJ308170 vs. SwissProt
Match: SEC14_YEAST (SEC14 cytosolic factor OS=Saccharomyces cerevisiae GN=SEC14 PE=1 SV=3)

HSP 1 Score: 57.7658 bits (138), Expect = 2.029e-8
Identity = 27/70 (38.57%), Postives = 46/70 (65.71%), Query Frame = 3
Query:   18 QSYYPERLAKCYILHMPWFFVSVWRLVSGFLDKATQEKIVIISNEDERKEFINEVGEEILPEEYGGRAKL 227
            Q+YYPER+ K YI++ P+ F + +RL   FLD  T  KI I+ +   +KE + ++  E LP ++GG++++
Sbjct:  202 QNYYPERMGKFYIINAPFGFSTAFRLFKPFLDPVTVSKIFILGS-SYQKELLKQIPAENLPVKFGGKSEV 270          
BLAST of AJ308170 vs. SwissProt
Match: SEC14_KLULA (SEC14 cytosolic factor OS=Kluyveromyces lactis GN=SEC14 PE=3 SV=2)

HSP 1 Score: 56.6102 bits (135), Expect = 4.520e-8
Identity = 25/70 (35.71%), Postives = 47/70 (67.14%), Query Frame = 3
Query:   18 QSYYPERLAKCYILHMPWFFVSVWRLVSGFLDKATQEKIVIISNEDERKEFINEVGEEILPEEYGGRAKL 227
            Q+YYPER+ K Y+++ P+ F + +RL   FLD  T  KI I+ +   +K+ + ++  E LP+++GG++++
Sbjct:  200 QNYYPERMGKFYLINAPFGFSTAFRLFKPFLDPVTVSKIFILGS-SYQKDLLKQIPAENLPKKFGGQSEV 268          
BLAST of AJ308170 vs. SwissProt
Match: SEC14_CANGA (SEC14 cytosolic factor OS=Candida glabrata GN=SEC14 PE=3 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 7.709e-8
Identity = 25/70 (35.71%), Postives = 45/70 (64.29%), Query Frame = 3
Query:   18 QSYYPERLAKCYILHMPWFFVSVWRLVSGFLDKATQEKIVIISNEDERKEFINEVGEEILPEEYGGRAKL 227
            Q+YYPER+ K Y+++ P+ F + +RL   FLD  T  KI I+ +   + E + ++  E LP ++GG++++
Sbjct:  200 QNYYPERMGKFYLINAPFGFSTAFRLFKPFLDPVTVSKIFILGS-SYQSELLKQIPAENLPSKFGGKSEV 268          
BLAST of AJ308170 vs. SwissProt
Match: SEC14_ASHGO (SEC14 cytosolic factor OS=Ashbya gossypii GN=SEC14 PE=3 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 1.007e-7
Identity = 26/68 (38.24%), Postives = 44/68 (64.71%), Query Frame = 3
Query:   18 QSYYPERLAKCYILHMPWFFVSVWRLVSGFLDKATQEKIVIISNEDERKEFINEVGEEILPEEYGGRA 221
            Q+YYPER+ K Y+++ P+ F + +RL   FLD  T  KI I+ +   +KE + ++  E LP ++GG++
Sbjct:  203 QNYYPERMGKFYMINAPFGFSAAFRLFKPFLDPVTVSKIFILGS-SYQKELLKQIPAENLPVKFGGQS 269          
BLAST of AJ308170 vs. TAIR peptide
Match: AT1G14820.1 (| Symbols: | Sec14p-like phosphatidylinositol transfer family protein | chr1:5105237-5106454 REVERSE LENGTH=239)

HSP 1 Score: 127.102 bits (318), Expect = 2.153e-30
Identity = 58/80 (72.50%), Postives = 70/80 (87.50%), Query Frame = 3
Query:    3 GFQFLQSYYPERLAKCYILHMPWFFVSVWRLVSGFLDKATQEKIVIISNEDERKEFINEVGEEILPEEYGGRAKLVAIQD 242
            GFQFLQSYYPERLAKCYILHMP FFV+VW+ V  FL+KATQEKIVI+++ +E+++F  E+G + LPEEYGGRAKL AIQD
Sbjct:  144 GFQFLQSYYPERLAKCYILHMPGFFVTVWKFVCRFLEKATQEKIVIVTDGEEQRKFEEEIGADALPEEYGGRAKLTAIQD 223          
BLAST of AJ308170 vs. TAIR peptide
Match: AT1G14820.2 (| Symbols: | Sec14p-like phosphatidylinositol transfer family protein | chr1:5105237-5106454 REVERSE LENGTH=239)

HSP 1 Score: 127.102 bits (318), Expect = 2.153e-30
Identity = 58/80 (72.50%), Postives = 70/80 (87.50%), Query Frame = 3
Query:    3 GFQFLQSYYPERLAKCYILHMPWFFVSVWRLVSGFLDKATQEKIVIISNEDERKEFINEVGEEILPEEYGGRAKLVAIQD 242
            GFQFLQSYYPERLAKCYILHMP FFV+VW+ V  FL+KATQEKIVI+++ +E+++F  E+G + LPEEYGGRAKL AIQD
Sbjct:  144 GFQFLQSYYPERLAKCYILHMPGFFVTVWKFVCRFLEKATQEKIVIVTDGEEQRKFEEEIGADALPEEYGGRAKLTAIQD 223          
BLAST of AJ308170 vs. TAIR peptide
Match: AT1G14820.3 (| Symbols: | Sec14p-like phosphatidylinositol transfer family protein | chr1:5105237-5106793 REVERSE LENGTH=252)

HSP 1 Score: 127.102 bits (318), Expect = 2.153e-30
Identity = 58/80 (72.50%), Postives = 70/80 (87.50%), Query Frame = 3
Query:    3 GFQFLQSYYPERLAKCYILHMPWFFVSVWRLVSGFLDKATQEKIVIISNEDERKEFINEVGEEILPEEYGGRAKLVAIQD 242
            GFQFLQSYYPERLAKCYILHMP FFV+VW+ V  FL+KATQEKIVI+++ +E+++F  E+G + LPEEYGGRAKL AIQD
Sbjct:  157 GFQFLQSYYPERLAKCYILHMPGFFVTVWKFVCRFLEKATQEKIVIVTDGEEQRKFEEEIGADALPEEYGGRAKLTAIQD 236          
BLAST of AJ308170 vs. TAIR peptide
Match: AT1G01630.1 (| Symbols: | Sec14p-like phosphatidylinositol transfer family protein | chr1:229206-230675 FORWARD LENGTH=255)

HSP 1 Score: 72.7886 bits (177), Expect = 4.819e-14
Identity = 31/76 (40.79%), Postives = 49/76 (64.47%), Query Frame = 3
Query:   15 LQSYYPERLAKCYILHMPWFFVSVWRLVSGFLDKATQEKIVIISNEDERKEFINEVGEEILPEEYGGRAKLVAIQD 242
            LQ  YPERL K YI+H P+ F++ W+++  F+D  T++KIV + N+      + ++ E  LP+ YGG+  LV IQ+
Sbjct:  179 LQDCYPERLGKLYIVHAPYIFMTAWKVIYPFIDANTKKKIVFVENKKLTPTLLEDIDESQLPDIYGGKLPLVPIQE 254          
BLAST of AJ308170 vs. TAIR peptide
Match: AT4G36640.2 (| Symbols: | Sec14p-like phosphatidylinositol transfer family protein | chr4:17277187-17278181 REVERSE LENGTH=234)

HSP 1 Score: 51.2174 bits (121), Expect = 1.502e-7
Identity = 27/73 (36.99%), Postives = 40/73 (54.79%), Query Frame = 3
Query:   15 LQSYYPERLAKCYILHMPWFFVSVWRLVSGFLDKATQEKIVIISNEDERKE--FINEVGEEILPEEYGGRAKL 227
            LQ+YYPERL   ++ + P  F +V+R    FLD  T EK+  +  +D+  +         E LP+E+GG A L
Sbjct:  109 LQNYYPERLGIAFLYNPPRLFQAVYRAAKYFLDPRTAEKVKFVYPKDKASDELMTTHFDVENLPKEFGGEATL 181          
BLAST of AJ308170 vs. TAIR peptide
Match: AT4G36640.1 (| Symbols: | Sec14p-like phosphatidylinositol transfer family protein | chr4:17277187-17278447 REVERSE LENGTH=294)

HSP 1 Score: 51.2174 bits (121), Expect = 1.502e-7
Identity = 27/73 (36.99%), Postives = 40/73 (54.79%), Query Frame = 3
Query:   15 LQSYYPERLAKCYILHMPWFFVSVWRLVSGFLDKATQEKIVIISNEDERKE--FINEVGEEILPEEYGGRAKL 227
            LQ+YYPERL   ++ + P  F +V+R    FLD  T EK+  +  +D+  +         E LP+E+GG A L
Sbjct:  169 LQNYYPERLGIAFLYNPPRLFQAVYRAAKYFLDPRTAEKVKFVYPKDKASDELMTTHFDVENLPKEFGGEATL 241          
BLAST of AJ308170 vs. TAIR peptide
Match: AT1G75170.3 (| Symbols: | Sec14p-like phosphatidylinositol transfer family protein | chr1:28214744-28215686 FORWARD LENGTH=213)

HSP 1 Score: 50.0618 bits (118), Expect = 3.345e-7
Identity = 27/73 (36.99%), Postives = 41/73 (56.16%), Query Frame = 3
Query:   15 LQSYYPERLAKCYILHMPWFFVSVWRLVSGFLDKAT--QEKIVIISNEDERKEFINEVGEEILPEEYGGRAKL 227
            LQ++YPERLA  ++ + P  F + W++V  F+D  T  + K V   N +  +       EE LP E+GG+A L
Sbjct:   89 LQNHYPERLAVAFLYNPPRLFEAFWKIVKYFIDAKTFVKVKFVYPKNSESVELMSTFFDEENLPTEFGGKALL 161          
BLAST of AJ308170 vs. TAIR peptide
Match: AT1G75170.2 (| Symbols: | Sec14p-like phosphatidylinositol transfer family protein | chr1:28214405-28215686 FORWARD LENGTH=296)

HSP 1 Score: 50.0618 bits (118), Expect = 3.345e-7
Identity = 27/73 (36.99%), Postives = 41/73 (56.16%), Query Frame = 3
Query:   15 LQSYYPERLAKCYILHMPWFFVSVWRLVSGFLDKAT--QEKIVIISNEDERKEFINEVGEEILPEEYGGRAKL 227
            LQ++YPERLA  ++ + P  F + W++V  F+D  T  + K V   N +  +       EE LP E+GG+A L
Sbjct:  172 LQNHYPERLAVAFLYNPPRLFEAFWKIVKYFIDAKTFVKVKFVYPKNSESVELMSTFFDEENLPTEFGGKALL 244          
BLAST of AJ308170 vs. TAIR peptide
Match: AT1G75170.1 (| Symbols: | Sec14p-like phosphatidylinositol transfer family protein | chr1:28214405-28215686 FORWARD LENGTH=296)

HSP 1 Score: 50.0618 bits (118), Expect = 3.345e-7
Identity = 27/73 (36.99%), Postives = 41/73 (56.16%), Query Frame = 3
Query:   15 LQSYYPERLAKCYILHMPWFFVSVWRLVSGFLDKAT--QEKIVIISNEDERKEFINEVGEEILPEEYGGRAKL 227
            LQ++YPERLA  ++ + P  F + W++V  F+D  T  + K V   N +  +       EE LP E+GG+A L
Sbjct:  172 LQNHYPERLAVAFLYNPPRLFEAFWKIVKYFIDAKTFVKVKFVYPKNSESVELMSTFFDEENLPTEFGGKALL 244          
The following BLAST results are available for this feature:
BLAST of AJ308170 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
B7FM13_MEDTR4.149e-3985.71Putative uncharacterized protein OS=Medicago trunc... [more]
B9HJH3_POPTR4.158e-3172.41Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
D7T8K2_VITVI3.520e-3068.48Whole genome shotgun sequence of line PN40024, sca... [more]
A2PZE8_IPONI1.747e-2969.77SEC14 cytosolic factor / phosphoglyceride transfer... [more]
B9HVU4_POPTR8.671e-2969.88Predicted protein (Fragment) OS=Populus trichocarp... [more]
D7KCK0_ARALY2.523e-2875.00F10B6.22 OS=Arabidopsis lyrata subsp. lyrata GN=AR... [more]
B9T4M6_RICCO4.303e-2865.91Aspartate semialdehyde dehydrogenase, putative OS=... [more]
Q9LQU9_ARATH5.620e-2872.50F10B6.22 OS=Arabidopsis thaliana PE=4 SV=1[more]
Q8GXG8_ARATH5.620e-2872.50Putative phosphatidylinositol/ phosphatidylcholine... [more]
Q3EDC4_ARATH5.620e-2872.50AT1G14820 protein OS=Arabidopsis thaliana GN=AT1G1... [more]
back to top
BLAST of AJ308170 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Swissprot)
Total hits: 6
Match NameE-valueIdentityDescription
YKJ1_YEAST2.396e-941.43CRAL-TRIO domain-containing protein YKL091C OS=Sac... [more]
SEC14_SCHPO6.973e-937.68Sec14 cytosolic factor OS=Schizosaccharomyces pomb... [more]
SEC14_YEAST2.029e-838.57SEC14 cytosolic factor OS=Saccharomyces cerevisiae... [more]
SEC14_KLULA4.520e-835.71SEC14 cytosolic factor OS=Kluyveromyces lactis GN=... [more]
SEC14_CANGA7.709e-835.71SEC14 cytosolic factor OS=Candida glabrata GN=SEC1... [more]
SEC14_ASHGO1.007e-738.24SEC14 cytosolic factor OS=Ashbya gossypii GN=SEC14... [more]
back to top
BLAST of AJ308170 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide)
Total hits: 9
Match NameE-valueIdentityDescription
AT1G14820.12.153e-3072.50| Symbols: | Sec14p-like phosphatidylinositol tra... [more]
AT1G14820.22.153e-3072.50| Symbols: | Sec14p-like phosphatidylinositol tra... [more]
AT1G14820.32.153e-3072.50| Symbols: | Sec14p-like phosphatidylinositol tra... [more]
AT1G01630.14.819e-1440.79| Symbols: | Sec14p-like phosphatidylinositol tra... [more]
AT4G36640.21.502e-736.99| Symbols: | Sec14p-like phosphatidylinositol tra... [more]
AT4G36640.11.502e-736.99| Symbols: | Sec14p-like phosphatidylinositol tra... [more]
AT1G75170.33.345e-736.99| Symbols: | Sec14p-like phosphatidylinositol tra... [more]
AT1G75170.23.345e-736.99| Symbols: | Sec14p-like phosphatidylinositol tra... [more]
AT1G75170.13.345e-736.99| Symbols: | Sec14p-like phosphatidylinositol tra... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001251Cellular retinaldehyde-binding/triple function, C-terminalGENE3D3.40.525.10no descriptioncoord: 3..75
score: 1.1
IPR001251Cellular retinaldehyde-binding/triple function, C-terminalPFAMPF00650CRAL_TRIOcoord: 3..71
score: 4.1
IPR001251Cellular retinaldehyde-binding/triple function, C-terminalPROFILEPS50191CRAL_TRIOcoord: 1..77
score: 16
IPR001251Cellular retinaldehyde-binding/triple function, C-terminalSUPERFAMILY52087CRAL/TRIO domaincoord: 2..74
score: 3.3
NoneNo IPR availablePANTHERPTHR10174RETINALDEHYDE BINDING PROTEIN-RELATEDcoord: 1..73
score: 6.7
NoneNo IPR availablePANTHERPTHR10174:SF2ASPARTATE SEMIALDEHYDE DEHYDROGENASEcoord: 1..73
score: 6.7
NoneNo IPR availableSEGsegsegcoord: 38..59
score

Properties
Property NameValue
Singlet in analysisPisum sativum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>AJ308170 ID=AJ308170|Name=AJ308170|organism=Pisum sativum|type=EST|length=321bp
CTGGATTTCAATTTTTACAGAGTTACTACCCTGAACGTTTGGCAAAGTGT
TATATTTTACACATGCCATGGTTTTTTGTGAGTGTTTGGAGACTAGTTTC
TGGCTTCCTAGACAAGGCAACACAAGAAAAGATTGTGATTATAAGCAATG
AAGATGAGAGAAAGGAATTCATAAATGAAGTTGGTGAAGAGATTCTCCCA
GAAGAGTATGGTGGAAGAGCAAAGCTTGTAGCCATCCAAGATTTTGAAGT
GACACCATTAGAAAATGGAAGAACAAATTGATTAAAGTGTTTACTTGACA
ATCAAACAATCATTTTAGAGT
back to top
Annotated Terms
The following terms have been associated with this EST:
Vocabulary: INTERPRO
TermDefinition
IPR001251CRAL-TRIO_dom