CD859582

EST Overview
NameCD859582
Unique NameCD859582
TypeEST
OrganismPisum sativum (pea)
Sequence length505
Libraries
Library NameType
LIBEST_014001 G15cdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Pisum sativum unigene v2Pisum sativum unigene v2EST
Pisum sativum unigene v1Pisum sativum unigene v1EST
Homology
BLAST of CD859582 vs. TrEMBL
Match: Q702P1_PEA (Vicilin (Fragment) OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 1.684e-51
Identity = 103/104 (99.04%), Postives = 103/104 (99.04%), Query Frame = -2
Query:  193 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQRE 504
            EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQP QRE
Sbjct:  312 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 415          
BLAST of CD859582 vs. TrEMBL
Match: Q702P0_PEA (Vicilin (Fragment) OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 1.684e-51
Identity = 103/104 (99.04%), Postives = 103/104 (99.04%), Query Frame = -2
Query:  193 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQRE 504
            EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQP QRE
Sbjct:  312 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 415          
BLAST of CD859582 vs. TrEMBL
Match: Q43626_PEA (Vicilin 47k OS=Pisum sativum GN=vicK PE=2 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 1.684e-51
Identity = 103/104 (99.04%), Postives = 103/104 (99.04%), Query Frame = -2
Query:  193 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQRE 504
            EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQP QRE
Sbjct:  335 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 438          
BLAST of CD859582 vs. TrEMBL
Match: D3VNE1_PEA (Vicilin 47k OS=Pisum sativum GN=vc-2 PE=2 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 1.684e-51
Identity = 103/104 (99.04%), Postives = 103/104 (99.04%), Query Frame = -2
Query:  193 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQRE 504
            EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQP QRE
Sbjct:  335 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 438          
BLAST of CD859582 vs. TrEMBL
Match: D3VNE0_PEA (Vicilin 47k OS=Pisum sativum GN=vc-2 PE=2 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 1.684e-51
Identity = 103/104 (99.04%), Postives = 103/104 (99.04%), Query Frame = -2
Query:  193 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQRE 504
            EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQP QRE
Sbjct:  338 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 441          
BLAST of CD859582 vs. TrEMBL
Match: D3VND9_PEA (Vicilin 47k OS=Pisum sativum GN=vc-2 PE=2 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 1.684e-51
Identity = 103/104 (99.04%), Postives = 103/104 (99.04%), Query Frame = -2
Query:  193 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQRE 504
            EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQP QRE
Sbjct:  334 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 437          
BLAST of CD859582 vs. TrEMBL
Match: D3VND7_PEA (Vicilin 47k OS=Pisum sativum GN=vc-2 PE=2 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 1.684e-51
Identity = 103/104 (99.04%), Postives = 103/104 (99.04%), Query Frame = -2
Query:  193 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQRE 504
            EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQP QRE
Sbjct:  335 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 438          
BLAST of CD859582 vs. TrEMBL
Match: D3VNE2_PEA (Vicilin 47k OS=Pisum sativum GN=vc-2 PE=2 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 1.092e-50
Identity = 100/104 (96.15%), Postives = 103/104 (99.04%), Query Frame = -2
Query:  193 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQRE 504
            EQEEETSKQVQLY+AKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQV+RPVKELAFPGSSHE+DRLLKNQKQSYFANAQP QRE
Sbjct:  335 EQEEETSKQVQLYKAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVQRPVKELAFPGSSHEIDRLLKNQKQSYFANAQPLQRE 438          
BLAST of CD859582 vs. TrEMBL
Match: Q41677_VICNA (Vicilin OS=Vicia narbonensis PE=2 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 1.631e-46
Identity = 93/119 (78.15%), Postives = 109/119 (91.60%), Query Frame = -2
Query:  142 EEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQREIGSSETENRLSSILNAF 498
            +E T+ QVQ Y+AKLS GDVFVIPAGHPV+I ASS+L+L+GFGINA+NN+RNFLAGEEDNVISQ++RPVKELAFPGS+ EVDRLL+NQKQS+FANAQPQQRE GS ET + LSSIL+AF
Sbjct:  345 DENTNTQVQNYKAKLSRGDVFVIPAGHPVSIKASSNLDLLGFGINAKNNQRNFLAGEEDNVISQIDRPVKELAFPGSAQEVDRLLENQKQSHFANAQPQQRERGSHETRDHLSSILDAF 463          
BLAST of CD859582 vs. TrEMBL
Match: Q84UI0_LENCU (Allergen Len c 1.0102 (Fragment) OS=Lens culinaris PE=2 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 1.381e-45
Identity = 92/104 (88.46%), Postives = 98/104 (94.23%), Query Frame = -2
Query:  193 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQRE 504
            EQEEETS QVQ YRAKLSPGDVFV+PAGHPVAINASSDLNLIGFGINA+NN+RNFLAGEEDNVISQ++RPVKELAFPGSS EVDRLL NQKQS+FANAQP Q E
Sbjct:  312 EQEEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASSDLNLIGFGINAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE 415          
BLAST of CD859582 vs. SwissProt
Match: VCLA_PEA (Provicilin (Fragment) OS=Pisum sativum PE=3 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 2.171e-47
Identity = 91/121 (75.21%), Postives = 106/121 (87.60%), Query Frame = -2
Query:  142 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQREIGSSETENRLSSILNAF 504
            ++EEET  QVQ Y+AKL+PGDVFVIPAGHPVA+ ASS+LNL+GFGINAENN+RNFLAGEEDNVISQ+++ VK+L FPGS+ EVDRLL+NQKQSYFANAQPQQRE  S E +  L SIL AF
Sbjct:  155 QREEETKNQVQSYKAKLTPGDVFVIPAGHPVAVRASSNLNLLGFGINAENNQRNFLAGEEDNVISQIQKQVKDLTFPGSAQEVDRLLENQKQSYFANAQPQQRETRSQEIKEHLYSILGAF 275          
BLAST of CD859582 vs. SwissProt
Match: VCLC_PEA (Vicilin OS=Pisum sativum PE=2 SV=2)

HSP 1 Score: 186.422 bits (472), Expect = 6.317e-47
Identity = 90/115 (78.26%), Postives = 107/115 (93.04%), Query Frame = -2
Query:  154 EEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQREIGSSETENRLSSI 498
            EEE +KQVQ Y+AKLS GDVFVIPAGHPVA+ ASS+L+L+GFGINAENN+RNFLAG+EDNVISQ++RPVKELAFPGS+ EVDR+L+NQKQS+FA+AQPQQRE GS ET +RLSS+
Sbjct:  345 EEEINKQVQNYKAKLSSGDVFVIPAGHPVAVKASSNLDLLGFGINAENNQRNFLAGDEDNVISQIQRPVKELAFPGSAQEVDRILENQKQSHFADAQPQQRERGSRETRDRLSSV 459          
BLAST of CD859582 vs. SwissProt
Match: VCL_VICFA (Vicilin OS=Vicia faba PE=2 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 7.722e-45
Identity = 89/119 (74.79%), Postives = 104/119 (87.39%), Query Frame = -2
Query:  142 EEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQREIGSSETENRLSSILNAF 498
            EEE  KQVQ Y+AKLSPGDV VIPAG+PVAI ASS+LNL+GFGINAENN+R FLAGEEDNVISQ+ +PVKELAFPGS+ EVD LL+NQKQS+FANAQP++RE GS E ++ L SIL +F
Sbjct:  345 EEEIRKQVQNYKAKLSPGDVLVIPAGYPVAIKASSNLNLVGFGINAENNQRYFLAGEEDNVISQIHKPVKELAFPGSAQEVDTLLENQKQSHFANAQPRERERGSQEIKDHLYSILGSF 463          
BLAST of CD859582 vs. SwissProt
Match: VCLB_PEA (Provicilin (Fragment) OS=Pisum sativum PE=1 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 1.780e-41
Identity = 84/85 (98.82%), Postives = 84/85 (98.82%), Query Frame = -2
Query:  250 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDR 504
            EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIG GINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDR
Sbjct:  326 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGLGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDR 410          
BLAST of CD859582 vs. SwissProt
Match: CVCA_PEA (Convicilin OS=Pisum sativum GN=CVCA PE=1 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 1.780e-41
Identity = 79/121 (65.29%), Postives = 103/121 (85.12%), Query Frame = -2
Query:  142 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQREIGSSETENRLSSILNAF 504
            E  +E + +VQ Y A+LSPGDV +IPAGHPVAI+ASS+LNL+GFGINA+NN+RNFL+G +DNVISQ+E PVKEL FPGSS EV+RL+KNQKQS+FA+A+P+Q+E  S    + LSS+L++F
Sbjct:  450 EDRKERNNEVQRYEARLSPGDVVIIPAGHPVAISASSNLNLLGFGINAKNNQRNFLSGSDDNVISQIENPVKELTFPGSSQEVNRLIKNQKQSHFASAEPEQKEEESQRKRSPLSSVLDSF 570          
BLAST of CD859582 vs. SwissProt
Match: GLCB_SOYBN (Beta-conglycinin, beta chain OS=Glycine max GN=CG-4 PE=1 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 2.941e-36
Identity = 72/120 (60.00%), Postives = 95/120 (79.17%), Query Frame = -2
Query:  145 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQREIGSSETENRLSSILNA 504
            +++EE   +VQ YRA+LS  DVFVIPA +P  +NA+S+LN + FGINAENN+RNFLAGE+DNV+ Q+ER V+ELAFPGS+ +V+RLLK Q++SYF +AQPQQ+E GS   +    SIL A
Sbjct:  318 QKQEEEPLEVQRYRAELSEDDVFVIPAAYPFVVNATSNLNFLAFGINAENNQRNFLAGEKDNVVRQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKEEGSKGRKGPFPSILGA 437          
BLAST of CD859582 vs. SwissProt
Match: GLCA_SOYBN (Beta-conglycinin, alpha chain OS=Glycine max PE=2 SV=2)

HSP 1 Score: 149.058 bits (375), Expect = 1.118e-35
Identity = 71/121 (58.68%), Postives = 96/121 (79.34%), Query Frame = -2
Query:  142 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQREIGSSETENRLSSILNAF 504
            +Q+EE   +V+ YRA+LS  D+FVIPAG+PV +NA+S+LN    GINAENN+RNFLAG +DNVISQ+   V+ELAFPGS+  V++LLKNQ++SYF +AQP+++E G+   +  LSSIL AF
Sbjct:  484 QQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRKGPLSSILRAF 604          
BLAST of CD859582 vs. SwissProt
Match: GLCAP_SOYBN (Beta-conglycinin, alpha' chain OS=Glycine max GN=CG-1 PE=2 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 1.460e-35
Identity = 71/121 (58.68%), Postives = 95/121 (78.51%), Query Frame = -2
Query:  142 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQREIGSSETENRLSSILNAF 504
            +Q+EE   +V+ YRA+LS  D+FVIPAG+PV +NA+SDLN   FGINAENN+RNFLAG +DNVISQ+   V+ELAFP S+ +++ L+K+Q +SYF +AQPQQ+E G+   +  LSSIL AF
Sbjct:  518 QQQEEQPLEVRKYRAELSEQDIFVIPAGYPVMVNATSDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPRSAKDIENLIKSQSESYFVDAQPQQKEEGNKGRKGPLSSILRAF 638          
BLAST of CD859582 vs. SwissProt
Match: ALL11_ARAHY (Allergen Ara h 1, clone P17 OS=Arachis hypogaea PE=1 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 4.696e-34
Identity = 70/131 (53.44%), Postives = 99/131 (75.57%), Query Frame = -2
Query:  142 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQREIGSSETENR----------LSSILNAF 504
            E+EE ++++V+ Y A+L  GDVF++PA HPVAINASS+L+L+GFGINAENN R FLAG++DNVI Q+E+  K+LAFPGS  +V++L+KNQ++S+F +A+PQ +   S E E++          L SIL AF
Sbjct:  483 EEEEGSNREVRRYTARLKEGDVFIMPAAHPVAINASSELHLLGFGINAENNHRIFLAGDKDNVIDQIEKQAKDLAFPGSGEQVEKLIKNQRESHFVSARPQSQSPSSPEKEDQEEENQGGKGPLLSILKAF 613          
BLAST of CD859582 vs. SwissProt
Match: ALL12_ARAHY (Allergen Ara h 1, clone P41B OS=Arachis hypogaea PE=1 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 3.044e-33
Identity = 64/111 (57.66%), Postives = 90/111 (81.08%), Query Frame = -2
Query:  172 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQREIGSSETE 504
            E+EE ++++V+ Y A+L  GDVF++PA HPVAINASS+L+L+GFGINAENN R FLAG++DNVI Q+E+  K+LAFPGS  +V++L+KNQK+S+F +A+PQ +    S  E
Sbjct:  488 EEEEGSNREVRRYTARLKEGDVFIMPAAHPVAINASSELHLLGFGINAENNHRIFLAGDKDNVIDQIEKQAKDLAFPGSGEQVEKLIKNQKESHFVSARPQSQSQSPSSPE 598          
BLAST of CD859582 vs. TAIR peptide
Match: AT3G22640.1 (| Symbols: PAP85 | cupin family protein | chr3:8011902-8013883 REVERSE LENGTH=486)

HSP 1 Score: 75.0998 bits (183), Expect = 2.304e-14
Identity = 40/106 (37.74%), Postives = 62/106 (58.49%), Query Frame = -2
Query:  190 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAI-NASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQREI 504
            E+EE+ S+ V    +++  G+VF++PAGHP  I +   D   +GFGI A N++R FLAGEE N++S +      + F   S   ++L  +Q  SYFA     Q++I
Sbjct:  365 EEEEDMSENVHKVVSRVCKGEVFIVPAGHPFTILSQDQDFIAVGFGIYATNSKRTFLAGEE-NLLSNLNPAATRVTFGVGSKVAEKLFTSQNYSYFAPTSRSQQQI 469          
BLAST of CD859582 vs. TAIR peptide
Match: AT4G36700.1 (| Symbols: | RmlC-like cupins superfamily protein | chr4:17298443-17300337 REVERSE LENGTH=522)

HSP 1 Score: 55.0694 bits (131), Expect = 2.467e-8
Identity = 33/90 (36.67%), Postives = 52/90 (57.78%), Query Frame = -2
Query:  226 TSKQVQLYRAKLSPGDVFVIPAGHPVAINA--SSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQS 489
            TS + +  R K+  GD+F +P  HP+A  +  +  L  +GF  +A+NNE  FLAG ED+ +  ++R V   +   SS  +D LL  QK++
Sbjct:  342 TSSECKNVRFKVEEGDIFAVPRLHPMAQMSFNNDSLVFVGFTTSAKNNEPQFLAG-EDSALRMLDRQVLAASLNVSSVTIDGLLGAQKEA 430          
BLAST of CD859582 vs. TAIR peptide
Match: AT3G22640.1 (| Symbols: PAP85 | cupin family protein | chr3:8011902-8013883 REVERSE LENGTH=486)

HSP 1 Score: 75.0998 bits (183), Expect = 2.304e-14
Identity = 40/106 (37.74%), Postives = 62/106 (58.49%), Query Frame = -2
Query:  190 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAI-NASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQREI 504
            E+EE+ S+ V    +++  G+VF++PAGHP  I +   D   +GFGI A N++R FLAGEE N++S +      + F   S   ++L  +Q  SYFA     Q++I
Sbjct:  365 EEEEDMSENVHKVVSRVCKGEVFIVPAGHPFTILSQDQDFIAVGFGIYATNSKRTFLAGEE-NLLSNLNPAATRVTFGVGSKVAEKLFTSQNYSYFAPTSRSQQQI 469          
BLAST of CD859582 vs. TAIR peptide
Match: AT4G36700.1 (| Symbols: | RmlC-like cupins superfamily protein | chr4:17298443-17300337 REVERSE LENGTH=522)

HSP 1 Score: 55.0694 bits (131), Expect = 2.467e-8
Identity = 33/90 (36.67%), Postives = 52/90 (57.78%), Query Frame = -2
Query:  226 TSKQVQLYRAKLSPGDVFVIPAGHPVAINA--SSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQS 489
            TS + +  R K+  GD+F +P  HP+A  +  +  L  +GF  +A+NNE  FLAG ED+ +  ++R V   +   SS  +D LL  QK++
Sbjct:  342 TSSECKNVRFKVEEGDIFAVPRLHPMAQMSFNNDSLVFVGFTTSAKNNEPQFLAG-EDSALRMLDRQVLAASLNVSSVTIDGLLGAQKEA 430          
BLAST of CD859582 vs. TrEMBL
Match: Q702P1_PEA (Vicilin (Fragment) OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 2.046e-51
Identity = 103/104 (99.04%), Postives = 103/104 (99.04%), Query Frame = -2
Query:  193 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQRE 504
            EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQP QRE
Sbjct:  312 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 415          
BLAST of CD859582 vs. TrEMBL
Match: Q702P0_PEA (Vicilin (Fragment) OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 2.046e-51
Identity = 103/104 (99.04%), Postives = 103/104 (99.04%), Query Frame = -2
Query:  193 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQRE 504
            EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQP QRE
Sbjct:  312 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 415          
BLAST of CD859582 vs. TrEMBL
Match: Q43626_PEA (Vicilin 47k OS=Pisum sativum GN=vicK PE=2 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 2.046e-51
Identity = 103/104 (99.04%), Postives = 103/104 (99.04%), Query Frame = -2
Query:  193 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQRE 504
            EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQP QRE
Sbjct:  335 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 438          
BLAST of CD859582 vs. TrEMBL
Match: D3VNE1_PEA (Vicilin 47k OS=Pisum sativum GN=vc-2 PE=2 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 2.046e-51
Identity = 103/104 (99.04%), Postives = 103/104 (99.04%), Query Frame = -2
Query:  193 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQRE 504
            EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQP QRE
Sbjct:  335 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 438          
BLAST of CD859582 vs. TrEMBL
Match: D3VNE0_PEA (Vicilin 47k OS=Pisum sativum GN=vc-2 PE=2 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 2.046e-51
Identity = 103/104 (99.04%), Postives = 103/104 (99.04%), Query Frame = -2
Query:  193 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQRE 504
            EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQP QRE
Sbjct:  338 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 441          
BLAST of CD859582 vs. TrEMBL
Match: D3VND9_PEA (Vicilin 47k OS=Pisum sativum GN=vc-2 PE=2 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 2.046e-51
Identity = 103/104 (99.04%), Postives = 103/104 (99.04%), Query Frame = -2
Query:  193 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQRE 504
            EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQP QRE
Sbjct:  334 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 437          
BLAST of CD859582 vs. TrEMBL
Match: D3VND7_PEA (Vicilin 47k OS=Pisum sativum GN=vc-2 PE=2 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 2.046e-51
Identity = 103/104 (99.04%), Postives = 103/104 (99.04%), Query Frame = -2
Query:  193 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQRE 504
            EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQP QRE
Sbjct:  335 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 438          
BLAST of CD859582 vs. TrEMBL
Match: D3VNE2_PEA (Vicilin 47k OS=Pisum sativum GN=vc-2 PE=2 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 1.326e-50
Identity = 100/104 (96.15%), Postives = 103/104 (99.04%), Query Frame = -2
Query:  193 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQRE 504
            EQEEETSKQVQLY+AKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQV+RPVKELAFPGSSHE+DRLLKNQKQSYFANAQP QRE
Sbjct:  335 EQEEETSKQVQLYKAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVQRPVKELAFPGSSHEIDRLLKNQKQSYFANAQPLQRE 438          
BLAST of CD859582 vs. TrEMBL
Match: Q41677_VICNA (Vicilin OS=Vicia narbonensis PE=2 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 1.981e-46
Identity = 93/119 (78.15%), Postives = 109/119 (91.60%), Query Frame = -2
Query:  142 EEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQREIGSSETENRLSSILNAF 498
            +E T+ QVQ Y+AKLS GDVFVIPAGHPV+I ASS+L+L+GFGINA+NN+RNFLAGEEDNVISQ++RPVKELAFPGS+ EVDRLL+NQKQS+FANAQPQQRE GS ET + LSSIL+AF
Sbjct:  345 DENTNTQVQNYKAKLSRGDVFVIPAGHPVSIKASSNLDLLGFGINAKNNQRNFLAGEEDNVISQIDRPVKELAFPGSAQEVDRLLENQKQSHFANAQPQQRERGSHETRDHLSSILDAF 463          
BLAST of CD859582 vs. TrEMBL
Match: Q84UI0_LENCU (Allergen Len c 1.0102 (Fragment) OS=Lens culinaris PE=2 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 1.677e-45
Identity = 92/104 (88.46%), Postives = 98/104 (94.23%), Query Frame = -2
Query:  193 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQRE 504
            EQEEETS QVQ YRAKLSPGDVFV+PAGHPVAINASSDLNLIGFGINA+NN+RNFLAGEEDNVISQ++RPVKELAFPGSS EVDRLL NQKQS+FANAQP Q E
Sbjct:  312 EQEEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASSDLNLIGFGINAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE 415          
BLAST of CD859582 vs. Lotus protein
Match: chr5.CM0200.910.r2.m (- phase: 0 )

HSP 1 Score: 168.703 bits (426), Expect = 9.226e-43
Identity = 82/121 (67.77%), Postives = 100/121 (82.64%), Query Frame = -2
Query:  142 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQREIGSSETENRLSSILNAF 504
            E+EE+   + Q +RA+LSPGDV VIPAGHPVAINASSDLN I FGINAENN+R+FLAG +DNVISQ+E+ VKE+AFPGS+ +++RL+KNQ+ S+FANAQPQQRE G       LSSIL AF
Sbjct:  438 EEEEQPRIEAQRFRARLSPGDVVVIPAGHPVAINASSDLNFIAFGINAENNQRHFLAGGDDNVISQIEKVVKEIAFPGSAEDIERLIKNQRNSHFANAQPQQREEGGHGRRGPLSSILGAF 558          
BLAST of CD859582 vs. Lotus protein
Match: chr5.CM0200.930.r2.m (+ phase: 0 )

HSP 1 Score: 162.925 bits (411), Expect = 5.063e-41
Identity = 83/123 (67.48%), Postives = 101/123 (82.11%), Query Frame = -2
Query:  142 EQEEETSK-QVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQ-REIGSSETENRLSSILNAF 504
            EQEEE  + + Q +RA+LSPGDV VIPA HP A+ ASSDLNL+ FGINAENN+RNFLAG +DNVISQ+ERPVKELAFPGS+ E++ L+KNQ+ S FA+AQPQQ  E G S  +++LSSIL AF
Sbjct:  438 EQEEEQPRIEAQRFRARLSPGDVIVIPASHPFAVTASSDLNLLAFGINAENNQRNFLAGRDDNVISQIERPVKELAFPGSAEEIESLIKNQRNSCFASAQPQQGEEEGRSGKKDQLSSILGAF 560          
BLAST of CD859582 vs. Lotus protein
Match: LjSGA_020867.2 (+ phase: 1 /pseudo/partial)

HSP 1 Score: 72.7886 bits (177), Expect = 6.890e-14
Identity = 40/112 (35.71%), Postives = 69/112 (61.61%), Query Frame = -2
Query:  178 QEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINAS--SDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQP--QQREIGSSE 501
            QE ++S   Q   A+L PG VFV+PAGHP    AS  S+L ++ F +NA+NN++   AG + N++S +++  KEL+F   + +VD++ +  ++ +F   +   + +E G SE
Sbjct:  145 QERKSSPSYQKISARLRPGTVFVVPAGHPFVTIASNKSNLMILRFEVNAKNNKKLTFAG-KGNIVSALDKTAKELSFDYPADKVDKIFERDEEFFFPGPEAFVESKERGHSE 255          
BLAST of CD859582 vs. Soybean peptides
Match: Glyma10g39150.1|PACid:16281484 ()

HSP 1 Score: 152.14 bits (383), Expect = 2.207e-37
Identity = 72/121 (59.50%), Postives = 96/121 (79.34%), Query Frame = -2
Query:  142 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQREIGSSETENRLSSILNAF 504
            +Q+EE   +V+ YRA+LS  D+FVIPAG+PV +NA+SDLN   FGINAENN+RNFLAG +DNVISQ+   V+ELAFPGS+ +++ L+K+Q +SYF +AQPQQ+E G+   +  LSSIL AF
Sbjct:  500 QQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIENLIKSQSESYFVDAQPQQKEEGNKGRKGPLSSILRAF 620          
BLAST of CD859582 vs. Soybean peptides
Match: Glyma20g28640.1|PACid:16317166 ()

HSP 1 Score: 150.984 bits (380), Expect = 4.918e-37
Identity = 72/120 (60.00%), Postives = 95/120 (79.17%), Query Frame = -2
Query:  145 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQREIGSSETENRLSSILNA 504
            +++EE   +VQ YRA+LS  DVFVIPA +P  +NA+S+LN + FGINAENN+RNFLAGE+DNV+ Q+ER V+ELAFPGS+ +V+RLLK Q++SYF +AQPQQ+E GS   +    SIL A
Sbjct:  318 QKQEEEPLEVQRYRAELSEDDVFVIPAAYPFVVNATSNLNFLAFGINAENNQRNFLAGEKDNVVRQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKEEGSKGRKGPFPSILGA 437          
BLAST of CD859582 vs. Soybean peptides
Match: Glyma20g28460.2|PACid:16317146 ()

HSP 1 Score: 150.984 bits (380), Expect = 4.918e-37
Identity = 72/120 (60.00%), Postives = 95/120 (79.17%), Query Frame = -2
Query:  145 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQREIGSSETENRLSSILNA 504
            +++EE   +VQ YRA+LS  DVFVIPA +P  +NA+S+LN + FGINAENN+RNFLAGE+DNV+ Q+ER V+ELAFPGS+ +V+RLLK Q++SYF +AQPQQ+E GS   +    SIL A
Sbjct:  290 QKQEEEPLEVQRYRAELSEDDVFVIPAAYPFVVNATSNLNFLAFGINAENNQRNFLAGEKDNVVRQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKEEGSKGRKGPFPSILGA 409          
BLAST of CD859582 vs. Soybean peptides
Match: Glyma20g28460.1|PACid:16317145 ()

HSP 1 Score: 150.984 bits (380), Expect = 4.918e-37
Identity = 72/120 (60.00%), Postives = 95/120 (79.17%), Query Frame = -2
Query:  145 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQREIGSSETENRLSSILNA 504
            +++EE   +VQ YRA+LS  DVFVIPA +P  +NA+S+LN + FGINAENN+RNFLAGE+DNV+ Q+ER V+ELAFPGS+ +V+RLLK Q++SYF +AQPQQ+E GS   +    SIL A
Sbjct:  318 QKQEEEPLEVQRYRAELSEDDVFVIPAAYPFVVNATSNLNFLAFGINAENNQRNFLAGEKDNVVRQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKEEGSKGRKGPFPSILGA 437          
BLAST of CD859582 vs. Soybean peptides
Match: Glyma20g28660.1|PACid:16317169 ()

HSP 1 Score: 149.058 bits (375), Expect = 1.869e-36
Identity = 71/121 (58.68%), Postives = 96/121 (79.34%), Query Frame = -2
Query:  142 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQREIGSSETENRLSSILNAF 504
            +Q+EE   +V+ YRA+LS  D+FVIPAG+PV +NA+S+LN    GINAENN+RNFLAG +DNVISQ+   V+ELAFPGS+  V++LLKNQ++SYF +AQP+++E G+   +  LSSIL AF
Sbjct:  484 QQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRKGPLSSILRAF 604          
BLAST of CD859582 vs. Soybean peptides
Match: Glyma20g28650.1|PACid:16317167 ()

HSP 1 Score: 149.058 bits (375), Expect = 1.869e-36
Identity = 71/121 (58.68%), Postives = 96/121 (79.34%), Query Frame = -2
Query:  142 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQREIGSSETENRLSSILNAF 504
            +Q+EE   +V+ YRA+LS  D+FVIPAG+PV +NA+S+LN    GINAENN+RNFLAG +DNVISQ+   V+ELAFPGS+  V++LLKNQ++SYF +AQP+++E G+   +  LSSIL AF
Sbjct:  484 QQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRKGPLSSILRAF 604          
BLAST of CD859582 vs. Soybean peptides
Match: Glyma10g39170.1|PACid:16281486 ()

HSP 1 Score: 135.961 bits (341), Expect = 1.637e-32
Identity = 62/107 (57.94%), Postives = 89/107 (83.18%), Query Frame = -2
Query:  187 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFP-GSSHEVDRLLKNQKQSYFANAQPQQREIG 504
            +Q+ E +++V+ YRA+LS  D+FVIPA +P  +NA+S+LN + FGINAENN+RNFLAG +DNVI Q+++ VKELAFP GS+ +++ L+KNQ++SYFA+AQP Q+E G
Sbjct:  471 QQQGEETREVRKYRAELSEDDIFVIPAAYPFVVNATSNLNFVAFGINAENNQRNFLAGSKDNVIRQIQKQVKELAFPAGSAQDIENLIKNQRESYFADAQPLQKEEG 577          
BLAST of CD859582 vs. Soybean peptides
Match: Glyma20g28650.2|PACid:16317168 ()

HSP 1 Score: 79.337 bits (194), Expect = 1.818e-15
Identity = 36/58 (62.07%), Postives = 47/58 (81.03%), Query Frame = -2
Query:  331 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAG 504
            +Q+EE   +V+ YRA+LS  D+FVIPAG+PV +NA+S+LN    GINAENN+RNFLAG
Sbjct:  484 QQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAG 541          
BLAST of CD859582 vs. Soybean peptides
Match: Glyma10g39170.2|PACid:16281487 ()

HSP 1 Score: 78.5666 bits (192), Expect = 3.102e-15
Identity = 34/58 (58.62%), Postives = 48/58 (82.76%), Query Frame = -2
Query:  331 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAG 504
            +Q+ E +++V+ YRA+LS  D+FVIPA +P  +NA+S+LN + FGINAENN+RNFLAG
Sbjct:  471 QQQGEETREVRKYRAELSEDDIFVIPAAYPFVVNATSNLNFVAFGINAENNQRNFLAG 528          
BLAST of CD859582 vs. Soybean peptides
Match: Glyma10g03390.1|PACid:16278434 ()

HSP 1 Score: 57.7658 bits (138), Expect = 5.666e-9
Identity = 34/103 (33.01%), Postives = 57/103 (55.34%), Query Frame = -2
Query:  199 QEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNL--IGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQ 501
            + +++S       + L PG VFV+P GHP    AS+  NL  I F +NA +N++   AG +DN++S ++   KELAF   S  V+ +   ++  +F    P++
Sbjct:  395 KHDKSSPSYHRISSDLKPGMVFVVPPGHPFVTIASNKENLLMICFEVNARDNKKFTFAG-KDNIVSSLDNVAKELAFNYPSEMVNGVFDRKESFFFPFELPRE 496          
BLAST of CD859582 vs. SwissProt
Match: VCLA_PEA (Provicilin (Fragment) OS=Pisum sativum PE=3 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 2.211e-47
Identity = 91/121 (75.21%), Postives = 106/121 (87.60%), Query Frame = -2
Query:  142 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQREIGSSETENRLSSILNAF 504
            ++EEET  QVQ Y+AKL+PGDVFVIPAGHPVA+ ASS+LNL+GFGINAENN+RNFLAGEEDNVISQ+++ VK+L FPGS+ EVDRLL+NQKQSYFANAQPQQRE  S E +  L SIL AF
Sbjct:  155 QREEETKNQVQSYKAKLTPGDVFVIPAGHPVAVRASSNLNLLGFGINAENNQRNFLAGEEDNVISQIQKQVKDLTFPGSAQEVDRLLENQKQSYFANAQPQQRETRSQEIKEHLYSILGAF 275          
BLAST of CD859582 vs. SwissProt
Match: VCLC_PEA (Vicilin OS=Pisum sativum PE=2 SV=2)

HSP 1 Score: 186.422 bits (472), Expect = 6.432e-47
Identity = 90/115 (78.26%), Postives = 107/115 (93.04%), Query Frame = -2
Query:  154 EEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQREIGSSETENRLSSI 498
            EEE +KQVQ Y+AKLS GDVFVIPAGHPVA+ ASS+L+L+GFGINAENN+RNFLAG+EDNVISQ++RPVKELAFPGS+ EVDR+L+NQKQS+FA+AQPQQRE GS ET +RLSS+
Sbjct:  345 EEEINKQVQNYKAKLSSGDVFVIPAGHPVAVKASSNLDLLGFGINAENNQRNFLAGDEDNVISQIQRPVKELAFPGSAQEVDRILENQKQSHFADAQPQQRERGSRETRDRLSSV 459          
BLAST of CD859582 vs. SwissProt
Match: VCL_VICFA (Vicilin OS=Vicia faba PE=2 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 7.862e-45
Identity = 89/119 (74.79%), Postives = 104/119 (87.39%), Query Frame = -2
Query:  142 EEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQREIGSSETENRLSSILNAF 498
            EEE  KQVQ Y+AKLSPGDV VIPAG+PVAI ASS+LNL+GFGINAENN+R FLAGEEDNVISQ+ +PVKELAFPGS+ EVD LL+NQKQS+FANAQP++RE GS E ++ L SIL +F
Sbjct:  345 EEEIRKQVQNYKAKLSPGDVLVIPAGYPVAIKASSNLNLVGFGINAENNQRYFLAGEEDNVISQIHKPVKELAFPGSAQEVDTLLENQKQSHFANAQPRERERGSQEIKDHLYSILGSF 463          
BLAST of CD859582 vs. SwissProt
Match: VCLB_PEA (Provicilin (Fragment) OS=Pisum sativum PE=1 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 1.813e-41
Identity = 84/85 (98.82%), Postives = 84/85 (98.82%), Query Frame = -2
Query:  250 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDR 504
            EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIG GINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDR
Sbjct:  326 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGLGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDR 410          
BLAST of CD859582 vs. SwissProt
Match: CVCA_PEA (Convicilin OS=Pisum sativum GN=CVCA PE=1 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 1.813e-41
Identity = 79/121 (65.29%), Postives = 103/121 (85.12%), Query Frame = -2
Query:  142 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQREIGSSETENRLSSILNAF 504
            E  +E + +VQ Y A+LSPGDV +IPAGHPVAI+ASS+LNL+GFGINA+NN+RNFL+G +DNVISQ+E PVKEL FPGSS EV+RL+KNQKQS+FA+A+P+Q+E  S    + LSS+L++F
Sbjct:  450 EDRKERNNEVQRYEARLSPGDVVIIPAGHPVAISASSNLNLLGFGINAKNNQRNFLSGSDDNVISQIENPVKELTFPGSSQEVNRLIKNQKQSHFASAEPEQKEEESQRKRSPLSSVLDSF 570          
BLAST of CD859582 vs. SwissProt
Match: GLCB_SOYBN (Beta-conglycinin, beta chain OS=Glycine max GN=CG-4 PE=1 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 2.995e-36
Identity = 72/120 (60.00%), Postives = 95/120 (79.17%), Query Frame = -2
Query:  145 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQREIGSSETENRLSSILNA 504
            +++EE   +VQ YRA+LS  DVFVIPA +P  +NA+S+LN + FGINAENN+RNFLAGE+DNV+ Q+ER V+ELAFPGS+ +V+RLLK Q++SYF +AQPQQ+E GS   +    SIL A
Sbjct:  318 QKQEEEPLEVQRYRAELSEDDVFVIPAAYPFVVNATSNLNFLAFGINAENNQRNFLAGEKDNVVRQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKEEGSKGRKGPFPSILGA 437          
BLAST of CD859582 vs. SwissProt
Match: GLCA_SOYBN (Beta-conglycinin, alpha chain OS=Glycine max PE=2 SV=2)

HSP 1 Score: 149.058 bits (375), Expect = 1.138e-35
Identity = 71/121 (58.68%), Postives = 96/121 (79.34%), Query Frame = -2
Query:  142 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQREIGSSETENRLSSILNAF 504
            +Q+EE   +V+ YRA+LS  D+FVIPAG+PV +NA+S+LN    GINAENN+RNFLAG +DNVISQ+   V+ELAFPGS+  V++LLKNQ++SYF +AQP+++E G+   +  LSSIL AF
Sbjct:  484 QQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRKGPLSSILRAF 604          
BLAST of CD859582 vs. SwissProt
Match: GLCAP_SOYBN (Beta-conglycinin, alpha' chain OS=Glycine max GN=CG-1 PE=2 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 1.486e-35
Identity = 71/121 (58.68%), Postives = 95/121 (78.51%), Query Frame = -2
Query:  142 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQREIGSSETENRLSSILNAF 504
            +Q+EE   +V+ YRA+LS  D+FVIPAG+PV +NA+SDLN   FGINAENN+RNFLAG +DNVISQ+   V+ELAFP S+ +++ L+K+Q +SYF +AQPQQ+E G+   +  LSSIL AF
Sbjct:  518 QQQEEQPLEVRKYRAELSEQDIFVIPAGYPVMVNATSDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPRSAKDIENLIKSQSESYFVDAQPQQKEEGNKGRKGPLSSILRAF 638          
BLAST of CD859582 vs. SwissProt
Match: ALL11_ARAHY (Allergen Ara h 1, clone P17 OS=Arachis hypogaea PE=1 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 4.781e-34
Identity = 70/131 (53.44%), Postives = 99/131 (75.57%), Query Frame = -2
Query:  142 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQREIGSSETENR----------LSSILNAF 504
            E+EE ++++V+ Y A+L  GDVF++PA HPVAINASS+L+L+GFGINAENN R FLAG++DNVI Q+E+  K+LAFPGS  +V++L+KNQ++S+F +A+PQ +   S E E++          L SIL AF
Sbjct:  483 EEEEGSNREVRRYTARLKEGDVFIMPAAHPVAINASSELHLLGFGINAENNHRIFLAGDKDNVIDQIEKQAKDLAFPGSGEQVEKLIKNQRESHFVSARPQSQSPSSPEKEDQEEENQGGKGPLLSILKAF 613          
BLAST of CD859582 vs. SwissProt
Match: ALL12_ARAHY (Allergen Ara h 1, clone P41B OS=Arachis hypogaea PE=1 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 3.099e-33
Identity = 64/111 (57.66%), Postives = 90/111 (81.08%), Query Frame = -2
Query:  172 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQREIGSSETE 504
            E+EE ++++V+ Y A+L  GDVF++PA HPVAINASS+L+L+GFGINAENN R FLAG++DNVI Q+E+  K+LAFPGS  +V++L+KNQK+S+F +A+PQ +    S  E
Sbjct:  488 EEEEGSNREVRRYTARLKEGDVFIMPAAHPVAINASSELHLLGFGINAENNHRIFLAGDKDNVIDQIEKQAKDLAFPGSGEQVEKLIKNQKESHFVSARPQSQSQSPSSPE 598          
BLAST of CD859582 vs. Medicago proteins
Match: IMGA|Medtr7g079770.1 (Provicilin (Fragment) (AHRD V1 ***- P02854); contains Interpro domain(s) IPR014710 RmlC-like jelly roll fold chr07_pseudomolecule_IMGAG_V3.5 22543536-22546354 F EGN_Mt100125 20100825)

HSP 1 Score: 182.185 bits (461), Expect = 1.172e-46
Identity = 92/124 (74.19%), Postives = 108/124 (87.10%), Query Frame = -2
Query:  142 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQ--REIGSSETENRL-SSILNAF 504
            +QEEE S+QVQ YRA+LSPGDV+VIPAGHP  ++ASSDL+L+GFGINAENNERNFLAGEEDNVISQ+ERPVKE+AFPGS+ +V+ LLKNQ+QSYFANAQPQQ  RE G S+ +  L SSIL  F
Sbjct:  340 QQEEERSQQVQRYRARLSPGDVYVIPAGHPTVVSASSDLSLLGFGINAENNERNFLAGEEDNVISQIERPVKEVAFPGSAQDVESLLKNQRQSYFANAQPQQREREEGRSQRQRELISSILGVF 463          
BLAST of CD859582 vs. Medicago proteins
Match: IMGA|Medtr7g079820.1 (Convicilin (Fragment) (AHRD V1 ***- B0BCL8_VICFA); contains Interpro domain(s) IPR014710 RmlC-like jelly roll fold chr07_pseudomolecule_IMGAG_V3.5 22559589-22562019 F EGN_Mt100125 20100825)

HSP 1 Score: 181.8 bits (460), Expect = 1.530e-46
Identity = 88/124 (70.97%), Postives = 108/124 (87.10%), Query Frame = -2
Query:  142 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQREIGSSETENR---LSSILNAF 504
            EQ++E S+QVQ YRA+LSPGDV+VIPAGHP+ + ASSDL+L+GFGINAENN+RNFLAGEEDNVISQ+ERPVKE+AFPGS+ +V+ LLKNQ+QSYFANAQPQQRE     ++ +   +SSIL AF
Sbjct:  348 EQQQERSQQVQRYRARLSPGDVYVIPAGHPIVVKASSDLSLLGFGINAENNQRNFLAGEEDNVISQIERPVKEVAFPGSAQDVESLLKNQRQSYFANAQPQQREREEGRSQRQREPISSILGAF 471          
BLAST of CD859582 vs. Medicago proteins
Match: IMGA|Medtr7g079730.1 (Convicilin (Fragment) (AHRD V1 ***- B0BCJ4_PEA); contains Interpro domain(s) IPR014710 RmlC-like jelly roll fold chr07_pseudomolecule_IMGAG_V3.5 22531082-22533478 F EGN_Mt100125 20100825)

HSP 1 Score: 181.8 bits (460), Expect = 1.530e-46
Identity = 88/124 (70.97%), Postives = 108/124 (87.10%), Query Frame = -2
Query:  142 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQREIGSSETENR---LSSILNAF 504
            EQ++E S+QVQ YRA+LSPGDV+VIPAGHP+ + ASSDL+L+GFGINAENN+RNFLAGEEDNVISQ+ERPVKE+AFPGS+ +V+ LLKNQ+QSYFANAQPQQRE     ++ +   +SSIL AF
Sbjct:  341 EQQQERSQQVQRYRARLSPGDVYVIPAGHPIVVTASSDLSLLGFGINAENNQRNFLAGEEDNVISQIERPVKEVAFPGSAQDVESLLKNQRQSYFANAQPQQREREEGRSQRQREPISSILGAF 464          
BLAST of CD859582 vs. Medicago proteins
Match: IMGA|Medtr7g079780.1 (Convicilin (Fragment) (AHRD V1 ***- B0BCL6_VICNA); contains Interpro domain(s) IPR014710 RmlC-like jelly roll fold chr07_pseudomolecule_IMGAG_V3.5 22548736-22551151 F EGN_Mt100125 20100825)

HSP 1 Score: 176.407 bits (446), Expect = 6.430e-45
Identity = 87/124 (70.16%), Postives = 107/124 (86.29%), Query Frame = -2
Query:  142 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQREIGSSETENR---LSSILNAF 504
            EQEEE S+QVQ YRA+L+PGDV+VIPAG+P  + ASSDL+L+GFGINAENN+R+FLAGEEDNVISQ++RPVKELAFPGS+ +V+ LLKNQ+QSYFANAQPQQRE     ++ +   +SSIL AF
Sbjct:  341 EQEEERSQQVQRYRARLTPGDVYVIPAGYPNVVKASSDLSLLGFGINAENNQRSFLAGEEDNVISQIQRPVKELAFPGSAQDVESLLKNQRQSYFANAQPQQREREEGRSQRQREPISSILGAF 464          
BLAST of CD859582 vs. Medicago proteins
Match: IMGA|Medtr7g079740.1 (Convicilin (Fragment) (AHRD V1 ***- B0BCL4_9FABA); contains Interpro domain(s) IPR014710 RmlC-like jelly roll fold chr07_pseudomolecule_IMGAG_V3.5 22536046-22538501 F EGN_Mt100125 20100825)

HSP 1 Score: 172.94 bits (437), Expect = 7.109e-44
Identity = 85/124 (68.55%), Postives = 105/124 (84.68%), Query Frame = -2
Query:  142 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQREIGSSETENR---LSSILNAF 504
            EQEEE S+QVQ YRA+L+PGDV+VIPAG+P  + ASSDL+L+GFGINAENN+R+FLAGEEDNVISQ++RPVKELAFPGS+ +V+ LLKNQ+QSYFANAQPQQRE     ++ +   +SSI   F
Sbjct:  350 EQEEERSQQVQRYRARLTPGDVYVIPAGYPNVVKASSDLSLLGFGINAENNQRSFLAGEEDNVISQIQRPVKELAFPGSAQDVESLLKNQRQSYFANAQPQQREREEGRSQRKREPISSISGTF 473          
BLAST of CD859582 vs. Medicago proteins
Match: IMGA|Medtr1g071710.1 (Vicilin-like antimicrobial peptides 2-2 (AHRD V1 **-- Q9SPL4); contains Interpro domain(s) IPR014710 RmlC-like jelly roll fold chr01_pseudomolecule_IMGAG_V3.5 17782591-17780098 F EGN_Mt100125 20100825)

HSP 1 Score: 70.8626 bits (172), Expect = 3.804e-13
Identity = 40/115 (34.78%), Postives = 66/115 (57.39%), Query Frame = -2
Query:  166 EQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINAS--SDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPQQREIGSSETENR 504
            +Q   +S   Q   A+L PG VFV+PAGHP    AS  ++L ++ F +NA+ N++   AG ++N++S +++  K+LAF  S+ +VD + K  ++ +F    P   E  S E   R
Sbjct:  382 KQRRSSSTSYQKINARLRPGTVFVVPAGHPFVTIASKNNNLKIVCFEVNAQRNKKLAFAG-KNNIVSALDKTAKKLAFDKSAEKVDEIFKRDEEFFF----PYDVEDESKEEHGR 491          
The following BLAST results are available for this feature:
BLAST of CD859582 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
Q702P1_PEA1.684e-5199.04Vicilin (Fragment) OS=Pisum sativum PE=2 SV=1[more]
Q702P0_PEA1.684e-5199.04Vicilin (Fragment) OS=Pisum sativum PE=2 SV=1[more]
Q43626_PEA1.684e-5199.04Vicilin 47k OS=Pisum sativum GN=vicK PE=2 SV=1[more]
D3VNE1_PEA1.684e-5199.04Vicilin 47k OS=Pisum sativum GN=vc-2 PE=2 SV=1[more]
D3VNE0_PEA1.684e-5199.04Vicilin 47k OS=Pisum sativum GN=vc-2 PE=2 SV=1[more]
D3VND9_PEA1.684e-5199.04Vicilin 47k OS=Pisum sativum GN=vc-2 PE=2 SV=1[more]
D3VND7_PEA1.684e-5199.04Vicilin 47k OS=Pisum sativum GN=vc-2 PE=2 SV=1[more]
D3VNE2_PEA1.092e-5096.15Vicilin 47k OS=Pisum sativum GN=vc-2 PE=2 SV=1[more]
Q41677_VICNA1.631e-4678.15Vicilin OS=Vicia narbonensis PE=2 SV=1[more]
Q84UI0_LENCU1.381e-4588.46Allergen Len c 1.0102 (Fragment) OS=Lens culinaris... [more]
back to top
BLAST of CD859582 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Swissprot)
Total hits: 10
Match NameE-valueIdentityDescription
VCLA_PEA2.171e-4775.21Provicilin (Fragment) OS=Pisum sativum PE=3 SV=1[more]
VCLC_PEA6.317e-4778.26Vicilin OS=Pisum sativum PE=2 SV=2[more]
VCL_VICFA7.722e-4574.79Vicilin OS=Vicia faba PE=2 SV=1[more]
VCLB_PEA1.780e-4198.82Provicilin (Fragment) OS=Pisum sativum PE=1 SV=1[more]
CVCA_PEA1.780e-4165.29Convicilin OS=Pisum sativum GN=CVCA PE=1 SV=1[more]
GLCB_SOYBN2.941e-3660.00Beta-conglycinin, beta chain OS=Glycine max GN=CG-... [more]
GLCA_SOYBN1.118e-3558.68Beta-conglycinin, alpha chain OS=Glycine max PE=2 ... [more]
GLCAP_SOYBN1.460e-3558.68Beta-conglycinin, alpha' chain OS=Glycine max GN=C... [more]
ALL11_ARAHY4.696e-3453.44Allergen Ara h 1, clone P17 OS=Arachis hypogaea PE... [more]
ALL12_ARAHY3.044e-3357.66Allergen Ara h 1, clone P41B OS=Arachis hypogaea P... [more]
back to top
BLAST of CD859582 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide)
Total hits: 2
Match NameE-valueIdentityDescription
AT3G22640.12.304e-1437.74| Symbols: PAP85 | cupin family protein | chr3:801... [more]
AT4G36700.12.467e-836.67| Symbols: | RmlC-like cupins superfamily protein... [more]
back to top
BLAST of CD859582 vs. TAIR peptide
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs TAIR 10 peptide)
Total hits: 2
Match NameE-valueIdentityDescription
AT3G22640.12.304e-1437.74| Symbols: PAP85 | cupin family protein | chr3:801... [more]
AT4G36700.12.467e-836.67| Symbols: | RmlC-like cupins superfamily protein... [more]
back to top
BLAST of CD859582 vs. TrEMBL
Analysis Date: 2011-04-27 (Homology Analysis: Pisum sativum unigene v2 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
Q702P1_PEA2.046e-5199.04Vicilin (Fragment) OS=Pisum sativum PE=2 SV=1[more]
Q702P0_PEA2.046e-5199.04Vicilin (Fragment) OS=Pisum sativum PE=2 SV=1[more]
Q43626_PEA2.046e-5199.04Vicilin 47k OS=Pisum sativum GN=vicK PE=2 SV=1[more]
D3VNE1_PEA2.046e-5199.04Vicilin 47k OS=Pisum sativum GN=vc-2 PE=2 SV=1[more]
D3VNE0_PEA2.046e-5199.04Vicilin 47k OS=Pisum sativum GN=vc-2 PE=2 SV=1[more]
D3VND9_PEA2.046e-5199.04Vicilin 47k OS=Pisum sativum GN=vc-2 PE=2 SV=1[more]
D3VND7_PEA2.046e-5199.04Vicilin 47k OS=Pisum sativum GN=vc-2 PE=2 SV=1[more]
D3VNE2_PEA1.326e-5096.15Vicilin 47k OS=Pisum sativum GN=vc-2 PE=2 SV=1[more]
Q41677_VICNA1.981e-4678.15Vicilin OS=Vicia narbonensis PE=2 SV=1[more]
Q84UI0_LENCU1.677e-4588.46Allergen Len c 1.0102 (Fragment) OS=Lens culinaris... [more]
back to top
BLAST of CD859582 vs. Lotus protein
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Lotus proteins)
Total hits: 3
Match NameE-valueIdentityDescription
chr5.CM0200.910.r2.m9.226e-4367.77- phase: 0 [more]
chr5.CM0200.930.r2.m5.063e-4167.48+ phase: 0 [more]
LjSGA_020867.26.890e-1435.71+ phase: 1 /pseudo/partial[more]
back to top
BLAST of CD859582 vs. Soybean peptides
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Soybean peptides)
Total hits: 10
Match NameE-valueIdentityDescription
Glyma10g39150.1|PACid:162814842.207e-3759.50[more]
Glyma20g28640.1|PACid:163171664.918e-3760.00[more]
Glyma20g28460.2|PACid:163171464.918e-3760.00[more]
Glyma20g28460.1|PACid:163171454.918e-3760.00[more]
Glyma20g28660.1|PACid:163171691.869e-3658.68[more]
Glyma20g28650.1|PACid:163171671.869e-3658.68[more]
Glyma10g39170.1|PACid:162814861.637e-3257.94[more]
Glyma20g28650.2|PACid:163171681.818e-1562.07[more]
Glyma10g39170.2|PACid:162814873.102e-1558.62[more]
Glyma10g03390.1|PACid:162784345.666e-933.01[more]
back to top
BLAST of CD859582 vs. SwissProt
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Swissprot)
Total hits: 10
Match NameE-valueIdentityDescription
VCLA_PEA2.211e-4775.21Provicilin (Fragment) OS=Pisum sativum PE=3 SV=1[more]
VCLC_PEA6.432e-4778.26Vicilin OS=Pisum sativum PE=2 SV=2[more]
VCL_VICFA7.862e-4574.79Vicilin OS=Vicia faba PE=2 SV=1[more]
VCLB_PEA1.813e-4198.82Provicilin (Fragment) OS=Pisum sativum PE=1 SV=1[more]
CVCA_PEA1.813e-4165.29Convicilin OS=Pisum sativum GN=CVCA PE=1 SV=1[more]
GLCB_SOYBN2.995e-3660.00Beta-conglycinin, beta chain OS=Glycine max GN=CG-... [more]
GLCA_SOYBN1.138e-3558.68Beta-conglycinin, alpha chain OS=Glycine max PE=2 ... [more]
GLCAP_SOYBN1.486e-3558.68Beta-conglycinin, alpha' chain OS=Glycine max GN=C... [more]
ALL11_ARAHY4.781e-3453.44Allergen Ara h 1, clone P17 OS=Arachis hypogaea PE... [more]
ALL12_ARAHY3.099e-3357.66Allergen Ara h 1, clone P41B OS=Arachis hypogaea P... [more]
back to top
BLAST of CD859582 vs. Medicago proteins
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Medicago proteins)
Total hits: 6
Match NameE-valueIdentityDescription
IMGA|Medtr7g079770.11.172e-4674.19Provicilin (Fragment) (AHRD V1 ***- P02854); conta... [more]
IMGA|Medtr7g079820.11.530e-4670.97Convicilin (Fragment) (AHRD V1 ***- B0BCL8_VICFA);... [more]
IMGA|Medtr7g079730.11.530e-4670.97Convicilin (Fragment) (AHRD V1 ***- B0BCJ4_PEA); c... [more]
IMGA|Medtr7g079780.16.430e-4570.16Convicilin (Fragment) (AHRD V1 ***- B0BCL6_VICNA);... [more]
IMGA|Medtr7g079740.17.109e-4468.55Convicilin (Fragment) (AHRD V1 ***- B0BCL4_9FABA);... [more]
IMGA|Medtr1g071710.13.804e-1334.78Vicilin-like antimicrobial peptides 2-2 (AHRD V1 *... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v2
Date Performed: 2011-04-27
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006045Cupin 1PFAMPF00190Cupin_1coord: 9..76
score: 2.6
IPR006045Cupin 1SMARTSM00835no descriptioncoord: 2..84
score: 0
IPR011051Cupin, RmlC-typeSUPERFAMILY51182RmlC-like cupinscoord: 1..107
score: 2.2
IPR014710RmlC-like jelly roll foldGENE3D2.60.120.10no descriptioncoord: 9..99
score: 1.1

Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006045Cupin 1PFAMPF00190Cupin_1coord: 9..76
score: 2.6
IPR006045Cupin 1SMARTSM00835no descriptioncoord: 2..84
score: 0
IPR011051Cupin, RmlC-typeSUPERFAMILY51182RmlC-like cupinscoord: 1..107
score: 2.2
IPR014710RmlC-like jelly roll foldGENE3D2.60.120.10no descriptioncoord: 9..99
score: 1.1

Properties
Property NameValue
Singlet in analysisPisum sativum unigene v2
Singlet in analysisPisum sativum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>CD859582 ID=CD859582|Name=CD859582|organism=Pisum sativum|type=EST|length=505bp
GCTCTTAATTTATTTATTCATAATAGAAAAGTAGAAATATAATTAGAGTT
ACAAGAGAACATTATTTTATTATCTTATTCTATGCTCACTATGAGCTATA
TCTCTTGATAACATACATGCATAATATTTGTTCACTCATTAAAAAGCATT
CAAAATTGAAGATAGACGGTTTTCTGTTTCAGAGCTTCCTATCTCTCTCT
GTTGAGGTTGAGCGTTTGCAAAATAAGATTGTTTTTGATTCTTTAGGAGC
CTATCAACCTCATGAGAAGATCCAGGAAATGCAAGCTCTTTAACTGGTCT
TTCTACTTGACTTATGACATTGTCTTCCTCACCTGCAAGGAAGTTTCTCT
CGTTGTTCTCGGCATTGATACCAAATCCAATCAGATTGAGATCTGAGGAG
GCATTTATGGCAACGGGGTGACCTGCTGGAATCACAAAAACATCACCTGG
AGACAACTTAGCTCTATACAGTTGCACTTGTTTGCTTGTCTCTTCTTCTT
GTTCC
back to top
Annotated Terms
The following terms have been associated with this EST:
Vocabulary: Molecular Function
TermDefinition
GO:0045735nutrient reservoir activity
Vocabulary: INTERPRO
TermDefinition
IPR006045Cupin_1
IPR011051RmlC_Cupin_sf
IPR014710RmlC-like_jellyroll