CD860205

EST Overview
NameCD860205
Unique NameCD860205
TypeEST
OrganismPisum sativum (pea)
Sequence length671
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
Pisum sativum unigene v12010-12-27
Homology Analysis: Pisum sativum unigene v1 vs Trembl2010-12-28
Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide2011-02-03
InterProScan analysis for Pisum sativum unigene v12010-12-29
Libraries
Library NameType
LIBEST_014002 PWcdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Pisum sativum unigene v1Pisum sativum unigene v1EST
Homology
BLAST of CD860205 vs. TrEMBL
Match: C6SWU1_SOYBN (Putative uncharacterized protein OS=Glycine max PE=4 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 4.507e-22
Identity = 52/85 (61.18%), Postives = 64/85 (75.29%), Query Frame = -3
Query:  406 MAATVAVAQSHADPGHKCKTAISSIHRNRTSLFSAGSLLAIRPLSGFLASDV-------TEAEERMRQTDDSLRKVMYMNCWGQG 639
            MAATVAVAQ H +PGHKCKTA++SIH NR+ LFS G+L  +RPLSG +  DV       ++A+ R+ Q DDSLRKVMY +CWGQG
Sbjct:    1 MAATVAVAQGHTEPGHKCKTALNSIHHNRSRLFSGGALSDLRPLSGVVGPDVSGAAAGSSDAKNRVSQADDSLRKVMYFSCWGQG 85          
BLAST of CD860205 vs. TrEMBL
Match: B9RW76_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1176530 PE=4 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 3.128e-15
Identity = 43/92 (46.74%), Postives = 60/92 (65.22%), Query Frame = -3
Query:  406 MSYLNRVWMAATVAVAQSHADPGHKCKTAISSIHRNRTSLFSAGSLLAIRPLSGFLASDVT------EAEERMRQTDDSLRKVMYMNCWGQG 663
            MSYLNRV MAA+VAV Q H D G K  + + S+   + +LFS G +  +RPLSG   +D +      E ++R +Q D++ R+VMY+NCWGQG
Sbjct:    1 MSYLNRVCMAASVAVVQGHPDQGWK--SGLKSLQNGKRTLFSGGDVSELRPLSGVFGADRSGVPGSPEGQDRGKQNDETFRRVMYLNCWGQG 90          
BLAST of CD860205 vs. TrEMBL
Match: B9I6G9_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_663544 PE=4 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 2.648e-14
Identity = 46/92 (50.00%), Postives = 63/92 (68.48%), Query Frame = -3
Query:  406 MSYLNRVWMAATVAVAQSHADPGHKCKTAISSIHRNRTSLFSAGSLLAIRPLSGF-LASDVTE-----AEERMRQTDDSLRKVMYMNCWGQG 663
            MSYLNRVWMAATVA A  + D G K  +++ S+H  ++ +FS G ++ IRPL+   + SD        +EE +RQ D+SLR+VMY+NCWGQG
Sbjct:    1 MSYLNRVWMAATVA-AVGYPDQGWK--SSLKSLHHGKSRVFSGGDVVEIRPLAAASVGSDCIGLGGCGSEEGVRQNDESLRQVMYLNCWGQG 89          
BLAST of CD860205 vs. TrEMBL
Match: B9INV6_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_574596 PE=4 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 7.705e-14
Identity = 45/92 (48.91%), Postives = 57/92 (61.96%), Query Frame = -3
Query:  406 MSYLNRVWMAATVAVAQSHADPGHKCKTAISSIHRNRTSLFSAGSLLAIRPLSGFLASDVTEA------EERMRQTDDSLRKVMYMNCWGQG 663
            MSYLNRVW+AATVA  + H D G K    + S+ + +  +FS G    IRPL+G + SD          E  +RQ DDSLR+VMY+NCWGQG
Sbjct:    1 MSYLNRVWVAATVAAVR-HPDQGWKSN--LKSLQQGKMRVFSRGDATEIRPLAGSVESDCGGVFGSCGLEGGVRQNDDSLRRVMYLNCWGQG 89          
BLAST of CD860205 vs. TrEMBL
Match: Q94A22_ARATH (AT4g28240/F26K10_120 OS=Arabidopsis thaliana GN=At4g28240 PE=4 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.607e-11
Identity = 42/91 (46.15%), Postives = 56/91 (61.54%), Query Frame = -3
Query:  406 MSYLNRVWMAATVAVAQSHADPGHKCKTAISSIHRNRTSLFSAGSLLAIRPLSGF-LASDVTEAEERMRQT----DDSLRKVMYMNCWGQG 663
            MSYLN+VWMAA+    Q +AD G K K+ ++S HR +  L S      +RPL+   L  D   +EER R +    D+SLR+VMY+NCW QG
Sbjct:    1 MSYLNKVWMAASFVAVQGNADHGVKLKSGLTSAHRLQRRLSS-----DLRPLAAADLTGDSLPSEERRRTSSSTPDESLRQVMYLNCWAQG 86          
BLAST of CD860205 vs. TrEMBL
Match: D7MDL6_ARALY (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_491951 PE=4 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.607e-11
Identity = 42/91 (46.15%), Postives = 56/91 (61.54%), Query Frame = -3
Query:  406 MSYLNRVWMAATVAVAQSHADPGHKCKTAISSIHRNRTSLFSAGSLLAIRPLSGF-LASDVTEAEERMRQT----DDSLRKVMYMNCWGQG 663
            MSYLN+VWMAA+    Q +AD G K K+ ++S HR +  L S      +RPL+   L  D   +EER R +    D+SLR+VMY+NCW QG
Sbjct:    1 MSYLNKVWMAASFVAVQGNADHGVKLKSGLTSAHRLQRRLSS-----DLRPLAAADLTGDSLPSEERRRTSSSTPDESLRQVMYLNCWAQG 86          
BLAST of CD860205 vs. TrEMBL
Match: A8IXM2_BRACM (Wound-responsive protein-related OS=Brassica campestris PE=4 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 7.463e-9
Identity = 39/94 (41.49%), Postives = 54/94 (57.45%), Query Frame = -3
Query:  406 MSYLNRVWMAATVAVAQSHADPGHKCKTAISSIHRNRTSLFSAGSLLAIRPLSGF-LASDVTEAEERMRQT-------DDSLRKVMYMNCWGQG 663
            M+YLN+VWMAA+    Q + D G K KT++SS HR +  L S      + PLS   +  D   +EER   +       D+SLR+VMY++CW QG
Sbjct:    1 MNYLNKVWMAASFVAVQGNPDHGVKLKTSLSSAHRLQRRLSS-----DLLPLSAADVPVDDVPSEERRHPSSSSSSTPDESLRQVMYLSCWSQG 89          
BLAST of CD860205 vs. TAIR peptide
Match: AT4G28240.1 (| Symbols: | Wound-responsive family protein | chr4:13997979-13998239 REVERSE LENGTH=86)

HSP 1 Score: 73.559 bits (179), Expect = 1.112e-13
Identity = 42/91 (46.15%), Postives = 56/91 (61.54%), Query Frame = -3
Query:  406 MSYLNRVWMAATVAVAQSHADPGHKCKTAISSIHRNRTSLFSAGSLLAIRPLSGF-LASDVTEAEERMRQT----DDSLRKVMYMNCWGQG 663
            MSYLN+VWMAA+    Q +AD G K K+ ++S HR +  L S      +RPL+   L  D   +EER R +    D+SLR+VMY+NCW QG
Sbjct:    1 MSYLNKVWMAASFVAVQGNADHGVKLKSGLTSAHRLQRRLSS-----DLRPLAAADLTGDSLPSEERRRTSSSTPDESLRQVMYLNCWAQG 86          
The following BLAST results are available for this feature:
BLAST of CD860205 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl)
Total hits: 7
Match NameE-valueIdentityDescription
C6SWU1_SOYBN4.507e-2261.18Putative uncharacterized protein OS=Glycine max PE... [more]
B9RW76_RICCO3.128e-1546.74Putative uncharacterized protein OS=Ricinus commun... [more]
B9I6G9_POPTR2.648e-1450.00Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
B9INV6_POPTR7.705e-1448.91Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
Q94A22_ARATH1.607e-1146.15AT4g28240/F26K10_120 OS=Arabidopsis thaliana GN=At... [more]
D7MDL6_ARALY1.607e-1146.15Putative uncharacterized protein OS=Arabidopsis ly... [more]
A8IXM2_BRACM7.463e-941.49Wound-responsive protein-related OS=Brassica campe... [more]
back to top
BLAST of CD860205 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide)
Total hits: 1
Match NameE-valueIdentityDescription
AT4G28240.11.112e-1346.15| Symbols: | Wound-responsive family protein | ch... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSEGsegsegcoord: 28..39
score
IPR022251Protein of unknown function wound-inducedPFAMPF12609DUF3774coord: 11..87
score: 2.3

Properties
Property NameValue
Singlet in analysisPisum sativum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>CD860205 ID=CD860205|Name=CD860205|organism=Pisum sativum|type=EST|length=671bp
AGAAAAAACCATCGATTTTCTTCAAATCGATCATGGCCAATCGATGTTCT
ATTTATGCAAAATAGAAGAAATATTTTCAGCTTTGAAATTTCTCTTGCAC
CTCCTTGTTTCCTTGATTTCAAATTTTCAACCTTTATGCTATTTTGGTTC
ATAACAATACTCTCCCATTAATTTTTTCTTGGAACAAATTTTCCTGAATC
CGCCTGTTTGAATGTTGAATGGAGAAGATGTTGTTTTCATAGACGTATCA
AACTGTCGAGAGGACTTCTACTGTTGTCTTTTTCCTCAGTCAAAAAACAA
CATAGGTTGCTTTTGCATTGCACCCTTTGAATCAACTTGACATTACCATT
GGTTTCTAATTCTTGAACACTCGTAAGTTTTGTTTTGTTCTGATCAATGG
CTTTAACCTTGTCCCCAACAGTTCATATACATAACTTTCCGGAGAGAATC
GTCGGTTTGTCTCATCCTCTCTTCCGCCTCAGTTACGTCCGATGCAAGGA
AGCCGGACAACGGCCGGATCGCCAACAAAGAACCGGCGGAGAAGAGGCTA
GTTCTGTTTCGGTGAATAGAACTGATAGCAGTTTTGCACTTGTGGCCTGG
ATCAGCGTGGCTTTGCGCCACCGCTACAGTTGCCGCCATCCAAACACGGT
TCAAGTAACTCATCATTGCTT
back to top
Annotated Terms
The following terms have been associated with this EST:
Vocabulary: INTERPRO
TermDefinition
IPR022251DUF3774_wound-induced