GH720451

EST Overview
NameGH720451
Unique NameGH720451
TypeEST
OrganismPisum sativum (pea)
Sequence length924
Libraries
Library NameType
LIBEST_024271 552NIcdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Pisum sativum unigene v2Pisum sativum unigene v2EST
Pisum sativum unigene v1Pisum sativum unigene v1EST
Homology
BLAST of GH720451 vs. TrEMBL
Match: B9SZ64_RICCO (Ring finger protein, putative OS=Ricinus communis GN=RCOM_0484420 PE=4 SV=1)

HSP 1 Score: 244.973 bits (624), Expect = 7.455e-63
Identity = 139/226 (61.50%), Postives = 168/226 (74.34%), Query Frame = -1
Query:  232 VEAPNRTKSSRSGLQGTPLAXLESPITPHG-GLLMSETTKSEPPTSVQSELHIPXTKNKSNGHKTKFGDDKDGXTLPSGPVKRKRLRPANQKRTAVSE-MSASAQLVLDATGSRCNRKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWFCTASTSKKLPASVGSSAKDFVMALSYCRK 903
            VEA NR+KSS+S  QG  L   E    P G   L     ++E P    SE+++P TKNK +G  +K  DDK+G  L    VKR+RL    +KR A+SE  SASA+++LDA G++ NR+N PIWF+LVASEDQ G+ SLPQISA YLRIKDG +PVS+IQKYL+KKL+L SEAEVEI+CRGQ VLP+LQ+HNLVDLWF TAS SKK+PASVGSSAKDFVM LSY RK
Sbjct:  219 VEAANRSKSSKSNSQGPSLPKSELLSGPDGDSQLPGIKFRAESPNGHVSEVYMPKTKNKEHGPDSKVQDDKNGTDLLHASVKRRRLTA--RKRAAMSEEFSASARVMLDAAGAKNNRRNCPIWFSLVASEDQKGDASLPQISAGYLRIKDGKMPVSFIQKYLVKKLDLTSEAEVEIMCRGQSVLPTLQLHNLVDLWFRTAS-SKKVPASVGSSAKDFVMVLSYNRK 441          
BLAST of GH720451 vs. TrEMBL
Match: B9I5G3_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_571049 PE=4 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 8.243e-62
Identity = 135/229 (58.95%), Postives = 165/229 (72.05%), Query Frame = -1
Query:  232 VEAPNRTKSSRSGLQGTPLAX---LESP-ITPHGGLLMSETTKSEPPTSVQSELHIPXTKNKSNGHKTKFGDDKDGXTLPSGPVKRKRLRPANQKRTAVSE-MSASAQLVLDATGSRCNRKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWFCTASTSKKLPASVGSSAKDFVMALSYCRK 903
            VEA NRTKSS+S  QG  L     L+ P   PH   L    +++E P    +E+++  TKNK +G      DDK+G       VKR+RL  A +KR A+SE +SASAQ ++DA G++ NR+N PIWF+LVASEDQ  + SLPQIS CYLRIKDG +PVS+IQKYL+KKL+L SE EVEI+CRGQPV P+L + NLVDLWF T STSKK+PASVGSSAKDFVM LSYCRK
Sbjct:  202 VEAANRTKSSKSHSQGLSLVKSGMLDDPDCEPH---LYETKSRAESPGGHHNEVYMSKTKNKEHGQGIGVQDDKNGKNSLPISVKRRRLTAA-RKRAALSEGLSASAQAMIDAAGAKSNRRNGPIWFSLVASEDQKEDASLPQISTCYLRIKDGKMPVSFIQKYLVKKLDLDSETEVEILCRGQPVGPTLPLQNLVDLWFRTGSTSKKVPASVGSSAKDFVMVLSYCRK 426          
BLAST of GH720451 vs. TrEMBL
Match: A5AFM2_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_006024 PE=4 SV=1)

HSP 1 Score: 221.476 bits (563), Expect = 8.827e-56
Identity = 119/220 (54.09%), Postives = 155/220 (70.45%), Query Frame = -1
Query:  250 VEAPNRTKSSRSGLQGTPLAXLESPITPHGGLLMSET-TKSEPPTSVQSELHIPXTKNKSNGHKTKFGDDKDGXTLPSGPVKRKRLRPANQKRTAVS-EMSASAQLVLDATGSRCNRKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWFCTASTSKKLPASVGSSAKDFVMA 903
            VEA NRTKSS+   QGT LA  E    P   + M +T  K+EP  +   E+ IP TK K +GHK K  DDK+G  L  GPVKR+R+R   +KR + S EM   AQ+VL A G++  R+N PIWF+LVASE+Q G   L +I A YLR+KDG +PVS+IQKYL+KKL+L +EAEVEI C+G+ V+P+LQ+  LV+LW  TASTSK++  SVG+SAK+FVM+
Sbjct:  221 VEAANRTKSSKFNSQGTSLAKSEPFNAPDSEVYMPKTKAKAEPLNAADGEVCIPKTKIKEHGHKIKVQDDKNGAALLPGPVKRRRMRAVGRKRISASGEMCTPAQVVLSAAGAKRGRRNCPIWFSLVASENQGGNGPLSKIPAYYLRVKDGNLPVSFIQKYLVKKLDLTNEAEVEIRCQGEAVVPTLQLQKLVELWLRTASTSKRVATSVGTSAKEFVMS 440          
BLAST of GH720451 vs. TrEMBL
Match: B9MZC8_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_810467 PE=4 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 4.843e-54
Identity = 112/182 (61.54%), Postives = 142/182 (78.02%), Query Frame = -1
Query:  232 TSVQSELHIPXTKNKSNGHKTKFGDDKDGXTLPSGPVKRKRLRPANQKRTAVSE-MSASAQLVLDATGSRCNRKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWFCTASTSKKLPASVGSSAKDFVMALSYCRK 774
            T   +++++  TKN+ +G   +  DDK+G       VKR+RL  A QKR A+SE + ASAQ ++DA  ++ NR+N PIWF+LVASEDQ  + SLPQISACYLRI+DG +PVS+IQKYL+KKL+L SE EVEI+CRGQPV P+L++ NLV+LWFCT STSKK+ ASVGSSAKDFVM LSYCRK
Sbjct:  223 TKSSNDIYMAKTKNE-HGQGIRVLDDKNGTNSLPVSVKRRRLTAA-QKRAAMSEGLGASAQAMVDAAAAKSNRRNGPIWFSLVASEDQKRDASLPQISACYLRIQDGKMPVSFIQKYLVKKLDLGSETEVEIMCRGQPVSPTLRLQNLVNLWFCTGSTSKKVSASVGSSAKDFVMVLSYCRK 402          
BLAST of GH720451 vs. TrEMBL
Match: D7TXF2_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_81.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00036276001 PE=4 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 1.193e-52
Identity = 119/228 (52.19%), Postives = 151/228 (66.23%), Query Frame = -1
Query:  223 VEAPNRTKSSRSGLQGTPLAXLESPITPHGGLLMSETTKSEPPTSVQSELHIPXTKNKSNGHKTKFGDDKDGXTLPSGPVKRKRLRPANQKRTAVS-EMSASAQLVLDATGSRCNRKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWFCTASTSKKLPASVGSSAKDFVMALSYCRKTLP 903
            VEA NRTKSS+   QGT LA                  KSEP  +  SE     TK K +GHK K  DDK+G  L  GPVKR+R+R   +KR + S EM   AQ+VL A G++  R+N PIWF+LVASE+Q G   L +I A YLR+KDG +PVS+IQKYL+KKL+L +EAEVEI C+G+ V+P+LQ+  LV+LW  TASTSK++  SVG+SAK+FVM L+Y R   P
Sbjct:  221 VEAANRTKSSKFNSQGTSLA------------------KSEPFNAPDSE-----TKIKEHGHKIKVQDDKNGAALLPGPVKRRRMRAVGRKRISASGEMCTPAQVVLSAAGAKRGRRNCPIWFSLVASENQGGNGPLSKIPAYYLRVKDGNLPVSFIQKYLVKKLDLTNEAEVEIRCQGEAVVPTLQLQKLVELWLRTASTSKRVATSVGTSAKEFVMVLTYTRVQAP 425          
BLAST of GH720451 vs. TrEMBL
Match: D7SQL7_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_141.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00000748001 PE=4 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 7.490e-47
Identity = 113/228 (49.56%), Postives = 143/228 (62.72%), Query Frame = -1
Query:  226 VEAPNRTKSSRSGLQGTPLAXLESPITPHGGLLMSETTKSEPPTSVQSELHIPXTKNKSNGHKTKFGDDKDGXTLPSGP-VKRKRLRPANQKRTAV-SEMSASAQLVLDATGSRCNRKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWFCTASTSKKLPASVGSSAKDFVMALSYCRKTL 903
            VE  NRTKS +   QG+ +                   KSEP      E  +  TK K +G K+K  D+K   T  S   VK K+L    ++R A   E+  S Q VL+A  +   R+   IWF+LVASEDQ G+ SLPQIS+ +LRIKD  VPVS+IQKYLM+KL+L SE EVEI C GQPVLP+LQ+HNLVDLW  TASTS+++PAS+GSS K+FVM L+Y R+ L
Sbjct:  221 VEVANRTKSLKFNSQGSAV-------------------KSEPMHVPDGESQVRKTKVKEHGRKSKVQDEKISTTPVSAESVKPKKLCRVRRRRAAAFGELGISPQAVLNAVNNH-KRRTGSIWFSLVASEDQEGDASLPQISSNFLRIKDVNVPVSFIQKYLMRKLDLTSETEVEIKCMGQPVLPTLQLHNLVDLWLQTASTSQRVPASIGSSGKEFVMVLAYARRLL 428          
BLAST of GH720451 vs. TrEMBL
Match: B9HUN4_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_804973 PE=4 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 5.934e-44
Identity = 109/234 (46.58%), Postives = 150/234 (64.10%), Query Frame = -1
Query:  223 VDLSVEAPNRTKSSRSGLQGTPLAXLESPITPHGGLLMSETTKSEPPTSVQSELHIPXTKNKSNGHKTKF-GDDKDGXTLPSGPVKRKRLRPANQKRTAVSE-MSASAQLVLDATGSRCNRKNSPIWFTLVASE-DQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWFCTASTSKKLPASVGSSAKDFVMALSYCRKTLP 915
            ++ SVE  ++TKS++S LQ                 ++ +  K +     QS      T  K +G K+K  G++ +  + PS  VK +RL+   QKR A SE ++  AQ ++DA  S+C+ + SPIWF+LVAS+ +Q G   LPQIS+CYLR+KDG++PVSYI+KYL +KL L  EAEVEI  RGQPV+ +LQ+HNLVD W  TAS S+++  +VGSSAKDFVM LSY RK  P
Sbjct:  206 LNCSVEGSSKTKSNKSELQE----------------ILVQIKKLDAQEKAQSL----KTSVKEHGDKSKVNGEESNSTSWPSVSVKSRRLQGMQQKRAAPSEGLNIPAQTIVDAN-SKCDTRLSPIWFSLVASDHEQGGSAPLPQISSCYLRVKDGSLPVSYIKKYLAQKLGLVREAEVEISMRGQPVVSTLQLHNLVDWWLQTASASERIRTTVGSSAKDFVMVLSYGRKAHP 418          
BLAST of GH720451 vs. TrEMBL
Match: B9HKE2_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_766427 PE=4 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 1.909e-42
Identity = 103/225 (45.78%), Postives = 144/225 (64.00%), Query Frame = -1
Query:  232 VEAPNRTKSSRSGLQGTPLAXLESPITPHGGLLMSETTKSEPPTSVQSELHIPXTKNKSNGHKTK-FGDDKDGXTLPSGPVKRKRLRPANQKRTAVSEMSASAQLVLDATGSRCNRKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWFCTASTSKKLPASVGSSAKDFVMALSYCRK 903
            VEA  +TKS++S LQ                 ++ +  K +   + + E     T  K +G K+K  G++ +  + PSG VK +RL+   QKR      +  AQ  +DA  S+C+R+ SPIW +LVAS++Q G   LPQIS+CYLR+KDG++PVS+I+KYL++KL L SEAEV+I+  GQPV  +LQ+HNLVD W  TAS S+++  +VGSSAKDFVM LSY RK
Sbjct:  196 VEAATKTKSNKSDLQE----------------IIVQIKKLD---AQEEEAQALKTSIKEHGDKSKVIGEESNSTSSPSGSVKPRRLQAMRQKREG---FNIPAQAAVDAN-SKCDRRFSPIWLSLVASDEQEGVAPLPQISSCYLRVKDGSLPVSHIKKYLVQKLGLVSEAEVDILLLGQPVASTLQLHNLVDWWSQTASASERIQTTVGSSAKDFVMVLSYGRK 397          
BLAST of GH720451 vs. TrEMBL
Match: D7T790_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_20.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00018105001 PE=4 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 2.111e-41
Identity = 103/227 (45.37%), Postives = 141/227 (62.11%), Query Frame = -1
Query:  232 VEAPNRTKSSRSGLQGTPLAXLESPITPHGGLLMSETTKSEPPTSVQSELHIPXTKNKSNGHKTKFGDDKDGXT-LPSGPVKRKRLRPANQKRTAVSEMSASAQLVLDATGSRCNRKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWFCTA--STSKKLPASVGSSAKDFVMALSYCRK 903
            VEA + TKS++  LQG+                     KS P      E H+P  K K  G K KF D+++G T +PSG VK  R+R   QK+ A  E  +   L  +   S+CN +  P+WF+LVAS++Q G+  LPQI + YLR++DG +PVS++QKYL++KL+L SE+EVEI  RGQPV+P+LQ+ +LVDLWF  A  +TS+     +GSSAK+FVM LSY RK
Sbjct:  265 VEACSGTKSNKLNLQGS-------------------LAKSTPSHVDDKEAHVPKAKLKERG-KLKFQDEENGTTHVPSGSVK-PRIRGGRQKKAATPEGFSIPALAENDGNSKCNIRACPVWFSLVASDNQEGDAPLPQIPSSYLRMRDGHLPVSFLQKYLVQKLHLNSESEVEITLRGQPVVPTLQLQSLVDLWFQAAAPTTSEATQPPIGSSAKEFVMVLSYGRK 470          
BLAST of GH720451 vs. TrEMBL
Match: B9GS64_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_1071260 PE=4 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 6.141e-41
Identity = 102/226 (45.13%), Postives = 135/226 (59.73%), Query Frame = -1
Query:  232 VEAPNRTKSSRSGLQGTPLAXLESPITPHGGLLMSETTKSEPPTSVQSELHIPXTKNKSNGHKTKFGDDKDGX-TLPSGPVKRKRLRPANQKRTAVSEMSA-SAQLVLDATGSRCNRKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWFCTASTSKKLPASVGSSAKDFVMALSYCRK 903
            VE  NRTKS +S  Q                       KSE      +E     TK K N  K+K  D+K+    +  GPV+ KRLR   QKR   + +S  S+  VLD   ++  R++  +WF+L+ASE Q GE  LPQI + YLR+KDG VPVS+IQKYLMKKL+LASEAEVEI C G+PV+P+L ++NLVD W  T   ++++P + G SAKD+VM L+Y RK
Sbjct:  227 VEVANRTKSFKSSPQ-------------------LNDAKSESRPVHDNEPRALRTKFKGNKDKSKVKDEKNNIDNVSEGPVEPKRLRRIRQKRAVFNNISGISSPAVLDTAAAKQERRSGTVWFSLLASE-QEGEAPLPQIPSSYLRLKDGNVPVSFIQKYLMKKLDLASEAEVEIRCMGRPVIPTLLLYNLVDQWLQTVPKTEQVPVTAGFSAKDYVMVLAYARK 432          
BLAST of GH720451 vs. SwissProt
Match: DRIP2_ARATH (E3 ubiquitin protein ligase DRIP2 OS=Arabidopsis thaliana GN=DRIP2 PE=1 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 3.382e-38
Identity = 88/188 (46.81%), Postives = 120/188 (63.83%), Query Frame = -1
Query:  232 KSEPPTSVQSELHIPXTKNKSNGHKTKFGDD--KDGXTLPSGPVKRKRLRPANQKRTAVSEMSASAQLVLDATGSRCNRKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWFCTASTSKKLPASVGSSAKDFVMALSYCRK 789
            KSE   +  +++    TK K +  K K  ++   +G    S     KR R   +KR++    S    L+  A   +  R+N  +WF+LVAS +Q GE SLPQI A YLRI+DG +PVS+IQKYLM+KL+L SE EVEI C G+PV+P+LQ+H+LVDLW  T S  +++ AS+GSSAK+FVM L Y RK
Sbjct:  228 KSELGNASHNDVQGSKTKTKDHKRKCKLEEEISNNGDPTTSETATLKRTRRTRRKRSSTFGDSR-IPLLPGAASLKQERRNGHVWFSLVASSNQEGEASLPQIPANYLRIRDGNIPVSFIQKYLMRKLDLKSEDEVEITCMGEPVIPTLQLHSLVDLWLETTSKHQRVAASIGSSAKEFVMVLVYSRK 414          
BLAST of GH720451 vs. SwissProt
Match: DRIP1_ARATH (E3 ubiquitin protein ligase DRIP1 OS=Arabidopsis thaliana GN=DRIP1 PE=1 SV=2)

HSP 1 Score: 155.992 bits (393), Expect = 2.863e-37
Identity = 86/189 (45.50%), Postives = 117/189 (61.90%), Query Frame = -1
Query:  232 TKSEPPTSVQSELHIPXTKNKSNGHKTKFGDDK--DGXTLPSGPVKRKRLRPANQKRTAVSEMSASAQLVLDATGSRCNRKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWFCTASTSKKLPASVGSSAKDFVMALSYCRK 792
            +KSE     +++     TK K+   K K  DDK  +G    S  V  KR+R   +KR+A +   +      D + ++  R+N P+WF+LVAS DQ G  SLPQI A +LRI+DG   VS+IQKYLM+KL+L SE E+EI C G+ V+P+L ++NLVDLW   +S  ++  A VGSSAKDF M L Y RK
Sbjct:  227 SKSEHANVSRNQFQGSKTKTKNKKRKCKREDDKSNNGDPTTSETVTPKRMRTTQRKRSATTLGDSRNLPQPDESSAKQERRNGPVWFSLVASNDQEGGTSLPQIPANFLRIRDGNTTVSFIQKYLMRKLDLESENEIEIKCMGEAVIPTLTLYNLVDLWLQKSSNHQRFAALVGSSAKDFTMVLVYARK 415          
BLAST of GH720451 vs. SwissProt
Match: DRIPH_ARATH (Probable E3 ubiquitin protein ligase DRIPH OS=Arabidopsis thaliana GN=At3g23060 PE=2 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 2.514e-25
Identity = 76/234 (32.48%), Postives = 120/234 (51.28%), Query Frame = -1
Query:  229 DAVDLSVEAPNRTKSSRSGLQGTPLAXLES---PITPHGGLLMSETTKSEPPTSVQSELHIPXTKNKSNGHKTKFGDDKDGXTLPSGPVKRKRLRPANQKRTAVSEMSASAQLVLDATGSRCNRKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWFCTASTSKKLPASVGSSAKDFVMALSYCRKT 921
            D V+  + + + T+ S   +Q   +   E+   P+  +   L+  + +     S Q         ++S   K K   +K     P   + R+ + PA    T  + +S   ++ ++       R N+P+WF+L  S+ QN E+ LP I+AC +R+KD  + VSY++KYLM KL L SE +VEI  R +PV  SL +HNLVD W  T    ++  A VGSSA +F+M L Y  K+
Sbjct:  244 DIVEPEISSDDDTEESVEPIQNKCVVNRETKEVPVQVNQNSLLISSDRDREDNSGQKLKTNGAATSRSRKKKGKKPVEKSYSLRPR--IGRRTVNPAAGTTTPEAPVSVEEEMKVEE-----GRNNNPVWFSLKPSKTQNIEMLLPPITACCIRVKDSNMTVSYLKKYLMVKLGLESEDQVEIWLRDEPVCSSLTLHNLVDWWVQTTPLPERQSAMVGSSAAEFIMDLYYSFKS 470          
BLAST of GH720451 vs. TAIR peptide
Match: AT2G30580.1 (| Symbols: DRIP2 | DREB2A-interacting protein 2 | chr2:13026444-13030363 FORWARD LENGTH=420)

HSP 1 Score: 159.073 bits (401), Expect = 3.290e-39
Identity = 88/188 (46.81%), Postives = 120/188 (63.83%), Query Frame = -1
Query:  232 KSEPPTSVQSELHIPXTKNKSNGHKTKFGDD--KDGXTLPSGPVKRKRLRPANQKRTAVSEMSASAQLVLDATGSRCNRKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWFCTASTSKKLPASVGSSAKDFVMALSYCRK 789
            KSE   +  +++    TK K +  K K  ++   +G    S     KR R   +KR++    S    L+  A   +  R+N  +WF+LVAS +Q GE SLPQI A YLRI+DG +PVS+IQKYLM+KL+L SE EVEI C G+PV+P+LQ+H+LVDLW  T S  +++ AS+GSSAK+FVM L Y RK
Sbjct:  228 KSELGNASHNDVQGSKTKTKDHKRKCKLEEEISNNGDPTTSETATLKRTRRTRRKRSSTFGDSR-IPLLPGAASLKQERRNGHVWFSLVASSNQEGEASLPQIPANYLRIRDGNIPVSFIQKYLMRKLDLKSEDEVEITCMGEPVIPTLQLHSLVDLWLETTSKHQRVAASIGSSAKEFVMVLVYSRK 414          
BLAST of GH720451 vs. TAIR peptide
Match: AT1G06770.2 (| Symbols: DRIP1 | DREB2A-interacting protein 1 | chr1:2079222-2080658 REVERSE LENGTH=307)

HSP 1 Score: 155.992 bits (393), Expect = 2.785e-38
Identity = 86/189 (45.50%), Postives = 117/189 (61.90%), Query Frame = -1
Query:  232 TKSEPPTSVQSELHIPXTKNKSNGHKTKFGDDK--DGXTLPSGPVKRKRLRPANQKRTAVSEMSASAQLVLDATGSRCNRKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWFCTASTSKKLPASVGSSAKDFVMALSYCRK 792
            +KSE     +++     TK K+   K K  DDK  +G    S  V  KR+R   +KR+A +   +      D + ++  R+N P+WF+LVAS DQ G  SLPQI A +LRI+DG   VS+IQKYLM+KL+L SE E+EI C G+ V+P+L ++NLVDLW   +S  ++  A VGSSAKDF M L Y RK
Sbjct:  113 SKSEHANVSRNQFQGSKTKTKNKKRKCKREDDKSNNGDPTTSETVTPKRMRTTQRKRSATTLGDSRNLPQPDESSAKQERRNGPVWFSLVASNDQEGGTSLPQIPANFLRIRDGNTTVSFIQKYLMRKLDLESENEIEIKCMGEAVIPTLTLYNLVDLWLQKSSNHQRFAALVGSSAKDFTMVLVYARK 301          
BLAST of GH720451 vs. TAIR peptide
Match: AT1G06770.1 (| Symbols: DRIP1 | DREB2A-interacting protein 1 | chr1:2079222-2081707 REVERSE LENGTH=421)

HSP 1 Score: 155.992 bits (393), Expect = 2.785e-38
Identity = 86/189 (45.50%), Postives = 117/189 (61.90%), Query Frame = -1
Query:  232 TKSEPPTSVQSELHIPXTKNKSNGHKTKFGDDK--DGXTLPSGPVKRKRLRPANQKRTAVSEMSASAQLVLDATGSRCNRKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWFCTASTSKKLPASVGSSAKDFVMALSYCRK 792
            +KSE     +++     TK K+   K K  DDK  +G    S  V  KR+R   +KR+A +   +      D + ++  R+N P+WF+LVAS DQ G  SLPQI A +LRI+DG   VS+IQKYLM+KL+L SE E+EI C G+ V+P+L ++NLVDLW   +S  ++  A VGSSAKDF M L Y RK
Sbjct:  227 SKSEHANVSRNQFQGSKTKTKNKKRKCKREDDKSNNGDPTTSETVTPKRMRTTQRKRSATTLGDSRNLPQPDESSAKQERRNGPVWFSLVASNDQEGGTSLPQIPANFLRIRDGNTTVSFIQKYLMRKLDLESENEIEIKCMGEAVIPTLTLYNLVDLWLQKSSNHQRFAALVGSSAKDFTMVLVYARK 415          
BLAST of GH720451 vs. TAIR peptide
Match: AT3G23060.1 (| Symbols: | RING/U-box superfamily protein | chr3:8200868-8203116 FORWARD LENGTH=480)

HSP 1 Score: 116.316 bits (290), Expect = 2.446e-26
Identity = 76/234 (32.48%), Postives = 120/234 (51.28%), Query Frame = -1
Query:  229 DAVDLSVEAPNRTKSSRSGLQGTPLAXLES---PITPHGGLLMSETTKSEPPTSVQSELHIPXTKNKSNGHKTKFGDDKDGXTLPSGPVKRKRLRPANQKRTAVSEMSASAQLVLDATGSRCNRKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWFCTASTSKKLPASVGSSAKDFVMALSYCRKT 921
            D V+  + + + T+ S   +Q   +   E+   P+  +   L+  + +     S Q         ++S   K K   +K     P   + R+ + PA    T  + +S   ++ ++       R N+P+WF+L  S+ QN E+ LP I+AC +R+KD  + VSY++KYLM KL L SE +VEI  R +PV  SL +HNLVD W  T    ++  A VGSSA +F+M L Y  K+
Sbjct:  244 DIVEPEISSDDDTEESVEPIQNKCVVNRETKEVPVQVNQNSLLISSDRDREDNSGQKLKTNGAATSRSRKKKGKKPVEKSYSLRPR--IGRRTVNPAAGTTTPEAPVSVEEEMKVEE-----GRNNNPVWFSLKPSKTQNIEMLLPPITACCIRVKDSNMTVSYLKKYLMVKLGLESEDQVEIWLRDEPVCSSLTLHNLVDWWVQTTPLPERQSAMVGSSAAEFIMDLYYSFKS 470          
BLAST of GH720451 vs. TAIR peptide
Match: AT5G13250.1 (| Symbols: | RING finger protein | chr5:4234486-4241615 FORWARD LENGTH=387)

HSP 1 Score: 78.5666 bits (192), Expect = 5.651e-15
Identity = 50/114 (43.86%), Postives = 67/114 (58.77%), Query Frame = -1
Query:  235 RKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEA-EVEIICRGQPVLPSLQMHNLVD-LW---FCTASTSKKLPASVGSSAKDFVMALSYCR 561
            R +S IWF L AS++Q  E  LPQI   YLRIKDG + V  + KYL+ KL L  E+ +VEI CRGQ + P L + ++ D +W     T+S S+ +     SS  D +M L Y R
Sbjct:  271 RPHSGIWFLLQASQNQTVEPFLPQIPKSYLRIKDGKMTVRLLMKYLVNKLRLEHESQQVEIRCRGQELEPVLTLQHVRDAIWRGSRDTSSLSQNITLLPNSSTSDHLMVLHYGR 384          
BLAST of GH720451 vs. TAIR peptide
Match: AT1G28080.1 (| Symbols: | RING finger protein | chr1:9789826-9790918 FORWARD LENGTH=291)

HSP 1 Score: 63.929 bits (154), Expect = 1.440e-10
Identity = 33/60 (55.00%), Postives = 41/60 (68.33%), Query Frame = -1
Query:  382 RKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEI 561
            R +S +WF L AS+ Q  E  LPQ++  YLRIKDG + V  + KYLMKKL L SE+EV I
Sbjct:  232 RPHSGLWFLLQASQFQEREPFLPQVNKSYLRIKDGRITVRLLIKYLMKKLELDSESEVNI 291          
BLAST of GH720451 vs. TAIR peptide
Match: AT2G30580.1 (| Symbols: DRIP2 | DREB2A-interacting protein 2 | chr2:13026444-13030363 FORWARD LENGTH=420)

HSP 1 Score: 159.073 bits (401), Expect = 3.290e-39
Identity = 88/188 (46.81%), Postives = 120/188 (63.83%), Query Frame = -1
Query:  232 KSEPPTSVQSELHIPXTKNKSNGHKTKFGDD--KDGXTLPSGPVKRKRLRPANQKRTAVSEMSASAQLVLDATGSRCNRKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWFCTASTSKKLPASVGSSAKDFVMALSYCRK 789
            KSE   +  +++    TK K +  K K  ++   +G    S     KR R   +KR++    S    L+  A   +  R+N  +WF+LVAS +Q GE SLPQI A YLRI+DG +PVS+IQKYLM+KL+L SE EVEI C G+PV+P+LQ+H+LVDLW  T S  +++ AS+GSSAK+FVM L Y RK
Sbjct:  228 KSELGNASHNDVQGSKTKTKDHKRKCKLEEEISNNGDPTTSETATLKRTRRTRRKRSSTFGDSR-IPLLPGAASLKQERRNGHVWFSLVASSNQEGEASLPQIPANYLRIRDGNIPVSFIQKYLMRKLDLKSEDEVEITCMGEPVIPTLQLHSLVDLWLETTSKHQRVAASIGSSAKEFVMVLVYSRK 414          
BLAST of GH720451 vs. TAIR peptide
Match: AT1G06770.2 (| Symbols: DRIP1 | DREB2A-interacting protein 1 | chr1:2079222-2080658 REVERSE LENGTH=307)

HSP 1 Score: 155.992 bits (393), Expect = 2.785e-38
Identity = 86/189 (45.50%), Postives = 117/189 (61.90%), Query Frame = -1
Query:  232 TKSEPPTSVQSELHIPXTKNKSNGHKTKFGDDK--DGXTLPSGPVKRKRLRPANQKRTAVSEMSASAQLVLDATGSRCNRKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWFCTASTSKKLPASVGSSAKDFVMALSYCRK 792
            +KSE     +++     TK K+   K K  DDK  +G    S  V  KR+R   +KR+A +   +      D + ++  R+N P+WF+LVAS DQ G  SLPQI A +LRI+DG   VS+IQKYLM+KL+L SE E+EI C G+ V+P+L ++NLVDLW   +S  ++  A VGSSAKDF M L Y RK
Sbjct:  113 SKSEHANVSRNQFQGSKTKTKNKKRKCKREDDKSNNGDPTTSETVTPKRMRTTQRKRSATTLGDSRNLPQPDESSAKQERRNGPVWFSLVASNDQEGGTSLPQIPANFLRIRDGNTTVSFIQKYLMRKLDLESENEIEIKCMGEAVIPTLTLYNLVDLWLQKSSNHQRFAALVGSSAKDFTMVLVYARK 301          
BLAST of GH720451 vs. TAIR peptide
Match: AT1G06770.1 (| Symbols: DRIP1 | DREB2A-interacting protein 1 | chr1:2079222-2081707 REVERSE LENGTH=421)

HSP 1 Score: 155.992 bits (393), Expect = 2.785e-38
Identity = 86/189 (45.50%), Postives = 117/189 (61.90%), Query Frame = -1
Query:  232 TKSEPPTSVQSELHIPXTKNKSNGHKTKFGDDK--DGXTLPSGPVKRKRLRPANQKRTAVSEMSASAQLVLDATGSRCNRKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWFCTASTSKKLPASVGSSAKDFVMALSYCRK 792
            +KSE     +++     TK K+   K K  DDK  +G    S  V  KR+R   +KR+A +   +      D + ++  R+N P+WF+LVAS DQ G  SLPQI A +LRI+DG   VS+IQKYLM+KL+L SE E+EI C G+ V+P+L ++NLVDLW   +S  ++  A VGSSAKDF M L Y RK
Sbjct:  227 SKSEHANVSRNQFQGSKTKTKNKKRKCKREDDKSNNGDPTTSETVTPKRMRTTQRKRSATTLGDSRNLPQPDESSAKQERRNGPVWFSLVASNDQEGGTSLPQIPANFLRIRDGNTTVSFIQKYLMRKLDLESENEIEIKCMGEAVIPTLTLYNLVDLWLQKSSNHQRFAALVGSSAKDFTMVLVYARK 415          
BLAST of GH720451 vs. TAIR peptide
Match: AT3G23060.1 (| Symbols: | RING/U-box superfamily protein | chr3:8200868-8203116 FORWARD LENGTH=480)

HSP 1 Score: 116.316 bits (290), Expect = 2.446e-26
Identity = 76/234 (32.48%), Postives = 120/234 (51.28%), Query Frame = -1
Query:  229 DAVDLSVEAPNRTKSSRSGLQGTPLAXLES---PITPHGGLLMSETTKSEPPTSVQSELHIPXTKNKSNGHKTKFGDDKDGXTLPSGPVKRKRLRPANQKRTAVSEMSASAQLVLDATGSRCNRKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWFCTASTSKKLPASVGSSAKDFVMALSYCRKT 921
            D V+  + + + T+ S   +Q   +   E+   P+  +   L+  + +     S Q         ++S   K K   +K     P   + R+ + PA    T  + +S   ++ ++       R N+P+WF+L  S+ QN E+ LP I+AC +R+KD  + VSY++KYLM KL L SE +VEI  R +PV  SL +HNLVD W  T    ++  A VGSSA +F+M L Y  K+
Sbjct:  244 DIVEPEISSDDDTEESVEPIQNKCVVNRETKEVPVQVNQNSLLISSDRDREDNSGQKLKTNGAATSRSRKKKGKKPVEKSYSLRPR--IGRRTVNPAAGTTTPEAPVSVEEEMKVEE-----GRNNNPVWFSLKPSKTQNIEMLLPPITACCIRVKDSNMTVSYLKKYLMVKLGLESEDQVEIWLRDEPVCSSLTLHNLVDWWVQTTPLPERQSAMVGSSAAEFIMDLYYSFKS 470          
BLAST of GH720451 vs. TAIR peptide
Match: AT5G13250.1 (| Symbols: | RING finger protein | chr5:4234486-4241615 FORWARD LENGTH=387)

HSP 1 Score: 78.5666 bits (192), Expect = 5.651e-15
Identity = 50/114 (43.86%), Postives = 67/114 (58.77%), Query Frame = -1
Query:  235 RKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEA-EVEIICRGQPVLPSLQMHNLVD-LW---FCTASTSKKLPASVGSSAKDFVMALSYCR 561
            R +S IWF L AS++Q  E  LPQI   YLRIKDG + V  + KYL+ KL L  E+ +VEI CRGQ + P L + ++ D +W     T+S S+ +     SS  D +M L Y R
Sbjct:  271 RPHSGIWFLLQASQNQTVEPFLPQIPKSYLRIKDGKMTVRLLMKYLVNKLRLEHESQQVEIRCRGQELEPVLTLQHVRDAIWRGSRDTSSLSQNITLLPNSSTSDHLMVLHYGR 384          
BLAST of GH720451 vs. TAIR peptide
Match: AT1G28080.1 (| Symbols: | RING finger protein | chr1:9789826-9790918 FORWARD LENGTH=291)

HSP 1 Score: 63.929 bits (154), Expect = 1.440e-10
Identity = 33/60 (55.00%), Postives = 41/60 (68.33%), Query Frame = -1
Query:  382 RKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEI 561
            R +S +WF L AS+ Q  E  LPQ++  YLRIKDG + V  + KYLMKKL L SE+EV I
Sbjct:  232 RPHSGLWFLLQASQFQEREPFLPQVNKSYLRIKDGRITVRLLIKYLMKKLELDSESEVNI 291          
BLAST of GH720451 vs. TrEMBL
Match: B9SZ64_RICCO (Ring finger protein, putative OS=Ricinus communis GN=RCOM_0484420 PE=4 SV=1)

HSP 1 Score: 244.973 bits (624), Expect = 9.114e-63
Identity = 139/226 (61.50%), Postives = 168/226 (74.34%), Query Frame = -1
Query:  232 VEAPNRTKSSRSGLQGTPLAXLESPITPHG-GLLMSETTKSEPPTSVQSELHIPXTKNKSNGHKTKFGDDKDGXTLPSGPVKRKRLRPANQKRTAVSE-MSASAQLVLDATGSRCNRKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWFCTASTSKKLPASVGSSAKDFVMALSYCRK 903
            VEA NR+KSS+S  QG  L   E    P G   L     ++E P    SE+++P TKNK +G  +K  DDK+G  L    VKR+RL    +KR A+SE  SASA+++LDA G++ NR+N PIWF+LVASEDQ G+ SLPQISA YLRIKDG +PVS+IQKYL+KKL+L SEAEVEI+CRGQ VLP+LQ+HNLVDLWF TAS SKK+PASVGSSAKDFVM LSY RK
Sbjct:  219 VEAANRSKSSKSNSQGPSLPKSELLSGPDGDSQLPGIKFRAESPNGHVSEVYMPKTKNKEHGPDSKVQDDKNGTDLLHASVKRRRLTA--RKRAAMSEEFSASARVMLDAAGAKNNRRNCPIWFSLVASEDQKGDASLPQISAGYLRIKDGKMPVSFIQKYLVKKLDLTSEAEVEIMCRGQSVLPTLQLHNLVDLWFRTAS-SKKVPASVGSSAKDFVMVLSYNRK 441          
BLAST of GH720451 vs. TrEMBL
Match: B9I5G3_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_571049 PE=4 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 1.008e-61
Identity = 135/229 (58.95%), Postives = 165/229 (72.05%), Query Frame = -1
Query:  232 VEAPNRTKSSRSGLQGTPLAX---LESP-ITPHGGLLMSETTKSEPPTSVQSELHIPXTKNKSNGHKTKFGDDKDGXTLPSGPVKRKRLRPANQKRTAVSE-MSASAQLVLDATGSRCNRKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWFCTASTSKKLPASVGSSAKDFVMALSYCRK 903
            VEA NRTKSS+S  QG  L     L+ P   PH   L    +++E P    +E+++  TKNK +G      DDK+G       VKR+RL  A +KR A+SE +SASAQ ++DA G++ NR+N PIWF+LVASEDQ  + SLPQIS CYLRIKDG +PVS+IQKYL+KKL+L SE EVEI+CRGQPV P+L + NLVDLWF T STSKK+PASVGSSAKDFVM LSYCRK
Sbjct:  202 VEAANRTKSSKSHSQGLSLVKSGMLDDPDCEPH---LYETKSRAESPGGHHNEVYMSKTKNKEHGQGIGVQDDKNGKNSLPISVKRRRLTAA-RKRAALSEGLSASAQAMIDAAGAKSNRRNGPIWFSLVASEDQKEDASLPQISTCYLRIKDGKMPVSFIQKYLVKKLDLDSETEVEILCRGQPVGPTLPLQNLVDLWFRTGSTSKKVPASVGSSAKDFVMVLSYCRK 426          
BLAST of GH720451 vs. TrEMBL
Match: A5AFM2_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_006024 PE=4 SV=1)

HSP 1 Score: 221.476 bits (563), Expect = 1.079e-55
Identity = 119/220 (54.09%), Postives = 155/220 (70.45%), Query Frame = -1
Query:  250 VEAPNRTKSSRSGLQGTPLAXLESPITPHGGLLMSET-TKSEPPTSVQSELHIPXTKNKSNGHKTKFGDDKDGXTLPSGPVKRKRLRPANQKRTAVS-EMSASAQLVLDATGSRCNRKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWFCTASTSKKLPASVGSSAKDFVMA 903
            VEA NRTKSS+   QGT LA  E    P   + M +T  K+EP  +   E+ IP TK K +GHK K  DDK+G  L  GPVKR+R+R   +KR + S EM   AQ+VL A G++  R+N PIWF+LVASE+Q G   L +I A YLR+KDG +PVS+IQKYL+KKL+L +EAEVEI C+G+ V+P+LQ+  LV+LW  TASTSK++  SVG+SAK+FVM+
Sbjct:  221 VEAANRTKSSKFNSQGTSLAKSEPFNAPDSEVYMPKTKAKAEPLNAADGEVCIPKTKIKEHGHKIKVQDDKNGAALLPGPVKRRRMRAVGRKRISASGEMCTPAQVVLSAAGAKRGRRNCPIWFSLVASENQGGNGPLSKIPAYYLRVKDGNLPVSFIQKYLVKKLDLTNEAEVEIRCQGEAVVPTLQLQKLVELWLRTASTSKRVATSVGTSAKEFVMS 440          
BLAST of GH720451 vs. TrEMBL
Match: B9MZC8_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_810467 PE=4 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 5.921e-54
Identity = 112/182 (61.54%), Postives = 142/182 (78.02%), Query Frame = -1
Query:  232 TSVQSELHIPXTKNKSNGHKTKFGDDKDGXTLPSGPVKRKRLRPANQKRTAVSE-MSASAQLVLDATGSRCNRKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWFCTASTSKKLPASVGSSAKDFVMALSYCRK 774
            T   +++++  TKN+ +G   +  DDK+G       VKR+RL  A QKR A+SE + ASAQ ++DA  ++ NR+N PIWF+LVASEDQ  + SLPQISACYLRI+DG +PVS+IQKYL+KKL+L SE EVEI+CRGQPV P+L++ NLV+LWFCT STSKK+ ASVGSSAKDFVM LSYCRK
Sbjct:  223 TKSSNDIYMAKTKNE-HGQGIRVLDDKNGTNSLPVSVKRRRLTAA-QKRAAMSEGLGASAQAMVDAAAAKSNRRNGPIWFSLVASEDQKRDASLPQISACYLRIQDGKMPVSFIQKYLVKKLDLGSETEVEIMCRGQPVSPTLRLQNLVNLWFCTGSTSKKVSASVGSSAKDFVMVLSYCRK 402          
BLAST of GH720451 vs. TrEMBL
Match: D7TXF2_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_81.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00036276001 PE=4 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 1.458e-52
Identity = 119/228 (52.19%), Postives = 151/228 (66.23%), Query Frame = -1
Query:  223 VEAPNRTKSSRSGLQGTPLAXLESPITPHGGLLMSETTKSEPPTSVQSELHIPXTKNKSNGHKTKFGDDKDGXTLPSGPVKRKRLRPANQKRTAVS-EMSASAQLVLDATGSRCNRKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWFCTASTSKKLPASVGSSAKDFVMALSYCRKTLP 903
            VEA NRTKSS+   QGT LA                  KSEP  +  SE     TK K +GHK K  DDK+G  L  GPVKR+R+R   +KR + S EM   AQ+VL A G++  R+N PIWF+LVASE+Q G   L +I A YLR+KDG +PVS+IQKYL+KKL+L +EAEVEI C+G+ V+P+LQ+  LV+LW  TASTSK++  SVG+SAK+FVM L+Y R   P
Sbjct:  221 VEAANRTKSSKFNSQGTSLA------------------KSEPFNAPDSE-----TKIKEHGHKIKVQDDKNGAALLPGPVKRRRMRAVGRKRISASGEMCTPAQVVLSAAGAKRGRRNCPIWFSLVASENQGGNGPLSKIPAYYLRVKDGNLPVSFIQKYLVKKLDLTNEAEVEIRCQGEAVVPTLQLQKLVELWLRTASTSKRVATSVGTSAKEFVMVLTYTRVQAP 425          
BLAST of GH720451 vs. TrEMBL
Match: D7SQL7_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_141.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00000748001 PE=4 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 9.157e-47
Identity = 113/228 (49.56%), Postives = 143/228 (62.72%), Query Frame = -1
Query:  226 VEAPNRTKSSRSGLQGTPLAXLESPITPHGGLLMSETTKSEPPTSVQSELHIPXTKNKSNGHKTKFGDDKDGXTLPSGP-VKRKRLRPANQKRTAV-SEMSASAQLVLDATGSRCNRKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWFCTASTSKKLPASVGSSAKDFVMALSYCRKTL 903
            VE  NRTKS +   QG+ +                   KSEP      E  +  TK K +G K+K  D+K   T  S   VK K+L    ++R A   E+  S Q VL+A  +   R+   IWF+LVASEDQ G+ SLPQIS+ +LRIKD  VPVS+IQKYLM+KL+L SE EVEI C GQPVLP+LQ+HNLVDLW  TASTS+++PAS+GSS K+FVM L+Y R+ L
Sbjct:  221 VEVANRTKSLKFNSQGSAV-------------------KSEPMHVPDGESQVRKTKVKEHGRKSKVQDEKISTTPVSAESVKPKKLCRVRRRRAAAFGELGISPQAVLNAVNNH-KRRTGSIWFSLVASEDQEGDASLPQISSNFLRIKDVNVPVSFIQKYLMRKLDLTSETEVEIKCMGQPVLPTLQLHNLVDLWLQTASTSQRVPASIGSSGKEFVMVLAYARRLL 428          
BLAST of GH720451 vs. TrEMBL
Match: B9HUN4_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_804973 PE=4 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 7.255e-44
Identity = 109/234 (46.58%), Postives = 150/234 (64.10%), Query Frame = -1
Query:  223 VDLSVEAPNRTKSSRSGLQGTPLAXLESPITPHGGLLMSETTKSEPPTSVQSELHIPXTKNKSNGHKTKF-GDDKDGXTLPSGPVKRKRLRPANQKRTAVSE-MSASAQLVLDATGSRCNRKNSPIWFTLVASE-DQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWFCTASTSKKLPASVGSSAKDFVMALSYCRKTLP 915
            ++ SVE  ++TKS++S LQ                 ++ +  K +     QS      T  K +G K+K  G++ +  + PS  VK +RL+   QKR A SE ++  AQ ++DA  S+C+ + SPIWF+LVAS+ +Q G   LPQIS+CYLR+KDG++PVSYI+KYL +KL L  EAEVEI  RGQPV+ +LQ+HNLVD W  TAS S+++  +VGSSAKDFVM LSY RK  P
Sbjct:  206 LNCSVEGSSKTKSNKSELQE----------------ILVQIKKLDAQEKAQSL----KTSVKEHGDKSKVNGEESNSTSWPSVSVKSRRLQGMQQKRAAPSEGLNIPAQTIVDAN-SKCDTRLSPIWFSLVASDHEQGGSAPLPQISSCYLRVKDGSLPVSYIKKYLAQKLGLVREAEVEISMRGQPVVSTLQLHNLVDWWLQTASASERIRTTVGSSAKDFVMVLSYGRKAHP 418          
BLAST of GH720451 vs. TrEMBL
Match: B9HKE2_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_766427 PE=4 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 2.334e-42
Identity = 103/225 (45.78%), Postives = 144/225 (64.00%), Query Frame = -1
Query:  232 VEAPNRTKSSRSGLQGTPLAXLESPITPHGGLLMSETTKSEPPTSVQSELHIPXTKNKSNGHKTK-FGDDKDGXTLPSGPVKRKRLRPANQKRTAVSEMSASAQLVLDATGSRCNRKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWFCTASTSKKLPASVGSSAKDFVMALSYCRK 903
            VEA  +TKS++S LQ                 ++ +  K +   + + E     T  K +G K+K  G++ +  + PSG VK +RL+   QKR      +  AQ  +DA  S+C+R+ SPIW +LVAS++Q G   LPQIS+CYLR+KDG++PVS+I+KYL++KL L SEAEV+I+  GQPV  +LQ+HNLVD W  TAS S+++  +VGSSAKDFVM LSY RK
Sbjct:  196 VEAATKTKSNKSDLQE----------------IIVQIKKLD---AQEEEAQALKTSIKEHGDKSKVIGEESNSTSSPSGSVKPRRLQAMRQKREG---FNIPAQAAVDAN-SKCDRRFSPIWLSLVASDEQEGVAPLPQISSCYLRVKDGSLPVSHIKKYLVQKLGLVSEAEVDILLLGQPVASTLQLHNLVDWWSQTASASERIQTTVGSSAKDFVMVLSYGRK 397          
BLAST of GH720451 vs. TrEMBL
Match: D7T790_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_20.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00018105001 PE=4 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 2.580e-41
Identity = 103/227 (45.37%), Postives = 141/227 (62.11%), Query Frame = -1
Query:  232 VEAPNRTKSSRSGLQGTPLAXLESPITPHGGLLMSETTKSEPPTSVQSELHIPXTKNKSNGHKTKFGDDKDGXT-LPSGPVKRKRLRPANQKRTAVSEMSASAQLVLDATGSRCNRKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWFCTA--STSKKLPASVGSSAKDFVMALSYCRK 903
            VEA + TKS++  LQG+                     KS P      E H+P  K K  G K KF D+++G T +PSG VK  R+R   QK+ A  E  +   L  +   S+CN +  P+WF+LVAS++Q G+  LPQI + YLR++DG +PVS++QKYL++KL+L SE+EVEI  RGQPV+P+LQ+ +LVDLWF  A  +TS+     +GSSAK+FVM LSY RK
Sbjct:  265 VEACSGTKSNKLNLQGS-------------------LAKSTPSHVDDKEAHVPKAKLKERG-KLKFQDEENGTTHVPSGSVK-PRIRGGRQKKAATPEGFSIPALAENDGNSKCNIRACPVWFSLVASDNQEGDAPLPQIPSSYLRMRDGHLPVSFLQKYLVQKLHLNSESEVEITLRGQPVVPTLQLQSLVDLWFQAAAPTTSEATQPPIGSSAKEFVMVLSYGRK 470          
BLAST of GH720451 vs. TrEMBL
Match: B9GS64_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_1071260 PE=4 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 7.508e-41
Identity = 102/226 (45.13%), Postives = 135/226 (59.73%), Query Frame = -1
Query:  232 VEAPNRTKSSRSGLQGTPLAXLESPITPHGGLLMSETTKSEPPTSVQSELHIPXTKNKSNGHKTKFGDDKDGX-TLPSGPVKRKRLRPANQKRTAVSEMSA-SAQLVLDATGSRCNRKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWFCTASTSKKLPASVGSSAKDFVMALSYCRK 903
            VE  NRTKS +S  Q                       KSE      +E     TK K N  K+K  D+K+    +  GPV+ KRLR   QKR   + +S  S+  VLD   ++  R++  +WF+L+ASE Q GE  LPQI + YLR+KDG VPVS+IQKYLMKKL+LASEAEVEI C G+PV+P+L ++NLVD W  T   ++++P + G SAKD+VM L+Y RK
Sbjct:  227 VEVANRTKSFKSSPQ-------------------LNDAKSESRPVHDNEPRALRTKFKGNKDKSKVKDEKNNIDNVSEGPVEPKRLRRIRQKRAVFNNISGISSPAVLDTAAAKQERRSGTVWFSLLASE-QEGEAPLPQIPSSYLRLKDGNVPVSFIQKYLMKKLDLASEAEVEIRCMGRPVIPTLLLYNLVDQWLQTVPKTEQVPVTAGFSAKDYVMVLAYARK 432          
BLAST of GH720451 vs. Lotus protein
Match: chr5.LjT29J15.30.r2.m (- phase: 0 /partial)

HSP 1 Score: 315.849 bits (808), Expect = 1.202e-86
Identity = 160/225 (71.11%), Postives = 182/225 (80.89%), Query Frame = -1
Query:  232 VEAPNRTKSSRSGLQGTPLAXLESPITPHGGLLMSETT-KSEPPTSVQSELHIPXTKNKSNGHKTKFGDDKDGXTLPSGPVKRKRLRPANQKRTAVSEMSASAQLVLDATGSRCNRKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWFCTASTSKKLPASVGSSAKDFVMALSYCRK 903
            VEA NRTKS ++  Q TP+A LE P T HGGL   ETT K+  P   Q+EL+IP  K K  GHK  FG DKD   +PSGP KRKRLRPA QKR A S+MSASA  +L AT  +CNRKNSPIWF+LVASEDQ G+ SLPQIS+CYLRI+DGTVPVS+IQKYL+KKLNLASE EVEI+C+GQPVLPSLQ+HN+VDLWF TASTSK++PASVGSSAKDFVM LSYCRK
Sbjct:  200 VEAANRTKSFKANSQATPVAELECPTTSHGGLDQPETTTKTGLPAFAQNELNIPKCKIKDTGHKKLFGVDKDAKCVPSGPAKRKRLRPAGQKRAAASDMSASAPGMLSATWGKCNRKNSPIWFSLVASEDQKGDASLPQISSCYLRIRDGTVPVSFIQKYLVKKLNLASETEVEIMCQGQPVLPSLQLHNVVDLWFRTASTSKRMPASVGSSAKDFVMVLSYCRK 424          
BLAST of GH720451 vs. Lotus protein
Match: chr1.CM0375.430.r2.d (- phase: 0 )

HSP 1 Score: 176.022 bits (445), Expect = 1.486e-44
Identity = 103/229 (44.98%), Postives = 144/229 (62.88%), Query Frame = -1
Query:  232 VEAPNRTKSSRSGLQGTPLAXLESPITPHGGLLMSETTKSEPPTSVQSELHIPXTKNKSNGHKTKFGDDKDGXTLPSG----PVKRKRLRPANQKRTAVSEMSASAQLVLDATGSRCNRKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWF-CTASTSKKLPASVGSSAKDFVMALSYCRK 903
            VE  +R+KS +S  QG+                     K EP    +S+  +  TKNK N  K K  +++    L S     P K +R+R   +K  A+ E   S Q VL ++ ++  R + PIWF+LVASE+Q G+  LPQI + Y+RIKDG++PVS+IQKYLMKKL+L+SE+EVE  C GQPV+P+L++HNLV+LW    AS+S ++PA++GSSAKDFVM L+Y RK
Sbjct:  158 VEVASRSKSFKSNAQGSD-------------------AKLEPIPVNESDSQVQKTKNKENKRKAKVENERISPHLVSSDTSKPNKLRRIR--KKKEPALGESGISPQAVLHSSSNKLLR-DGPIWFSLVASENQEGDAPLPQIPSSYVRIKDGSLPVSFIQKYLMKKLDLSSESEVENKCMGQPVIPTLRLHNLVELWLDSAASSSLRIPATIGSSAKDFVMVLAYARK 364          
BLAST of GH720451 vs. Lotus protein
Match: chr5.CM0071.540.r2.m (- phase: 0 /partial)

HSP 1 Score: 138.272 bits (347), Expect = 3.435e-33
Identity = 72/138 (52.17%), Postives = 101/138 (73.19%), Query Frame = -1
Query:  229 QKRTA-VSE-MSASAQLVLDATGSRCNRKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWFCTASTSKKLPASVGSSAKDFVMALSYCRKT 636
            ++RTA +SE ++  AQ  +D   S  ++   PIWF+LVAS+++     LPQI++CY+R++DG++PVS+I+KYL+KKL LASE EVEI  +GQPVL S Q+ NLVD W  T   ++++  S+GSSAKDFVM L Y RKT
Sbjct:  292 EERTAKISEDLNVPAQPEIDLN-SESSKAFGPIWFSLVASQEKEVGARLPQITSCYIRVRDGSLPVSFIKKYLVKKLYLASETEVEISLQGQPVLSSWQLQNLVDFWLQTVPANERIQTSIGSSAKDFVMVLKYSRKT 428          
BLAST of GH720451 vs. Lotus protein
Match: LjSGA_030015.1 (- phase: 2 /partial)

HSP 1 Score: 120.553 bits (301), Expect = 7.412e-28
Identity = 58/80 (72.50%), Postives = 66/80 (82.50%), Query Frame = -1
Query:  223 DGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWFCTASTSKKLPASVGSSAKDFVMALSYCRKTLP 462
            DG VPVS+I KYL KKLNLASEAEV I CRGQ +LPSL++HN+VDLW CT  +SKK+ ASVGSSAK+FVM LSY R  LP
Sbjct:    1 DGNVPVSFIHKYLAKKLNLASEAEVVITCRGQSLLPSLKLHNIVDLWLCTTPSSKKIRASVGSSAKEFVMVLSYSRNPLP 80          
BLAST of GH720451 vs. Soybean peptides
Match: Glyma10g30510.1|PACid:16280475 ()

HSP 1 Score: 350.132 bits (897), Expect = 1.537e-96
Identity = 176/228 (77.19%), Postives = 193/228 (84.65%), Query Frame = -1
Query:  223 VEAPNRTKSSRSGLQGTPLAXLESPITPHGGLLMSETT-KSEPPTSVQSELHIPXTKNKSNGHKTKFGDDKDGXTLPSGPVKRKRLRPANQKRTAVSEMSASAQLVLDATGSRCNRKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWFCTASTSKKLPASVGSSAKDFVMALSYCRKTLP 903
            VEA NRTKSSRS  Q TPLA LESP TPHGG   SETT K++ P S +SEL+IP +KNK  GHKT FGDDKD  +LPSGP KR+RLRPA QKR A SEMSAS+   LD TG +CNRKNSPIWF+LVASEDQ G++ LPQISACYLRIKDG VPVS+IQKYL+KKLNLA EAEVEI+CRGQPVLPSLQ+HNLVDLWF TASTSKK+PASVGSSAKDFVM LSYCRK LP
Sbjct:  204 VEAANRTKSSRSNSQATPLAKLESPTTPHGGQDTSETTTKTDLPASAKSELNIPKSKNKDTGHKTIFGDDKDANSLPSGPGKRRRLRPAGQKRVAASEMSASSPAPLDTTGGKCNRKNSPIWFSLVASEDQKGDVPLPQISACYLRIKDGAVPVSFIQKYLVKKLNLACEAEVEIMCRGQPVLPSLQLHNLVDLWFRTASTSKKIPASVGSSAKDFVMVLSYCRKALP 431          
BLAST of GH720451 vs. Soybean peptides
Match: Glyma20g36830.1|PACid:16318113 ()

HSP 1 Score: 251.136 bits (640), Expect = 9.718e-67
Identity = 123/147 (83.67%), Postives = 133/147 (90.48%), Query Frame = -1
Query:  223 KRKRLRPANQKRTAVSEMSASAQLVLDATGSRCNRKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWFCTASTSKKLPASVGSSAKDFVMALSYCRKTLP 663
            +R+RLRPA QKR A SEMSAS+   LDATG +CNRKNSPIWF+LVASEDQ G+  LPQISACYLRIKDGTVPVS+IQKYLMKKLNLASEAEVEI+C GQPVLPSLQ+HNLVDLWF TASTSKK+PASVGSSAKDFVM LSYCRK LP
Sbjct:  225 RRRRLRPAGQKRVAASEMSASSPAPLDATGGKCNRKNSPIWFSLVASEDQKGDFPLPQISACYLRIKDGTVPVSFIQKYLMKKLNLASEAEVEIMCGGQPVLPSLQLHNLVDLWFRTASTSKKIPASVGSSAKDFVMVLSYCRKALP 371          
BLAST of GH720451 vs. Soybean peptides
Match: Glyma19g34440.1|PACid:16313734 ()

HSP 1 Score: 183.726 bits (465), Expect = 1.905e-46
Identity = 107/226 (47.35%), Postives = 140/226 (61.95%), Query Frame = -1
Query:  232 VEAPNRTKSSRSGLQGTPLAXLESPITPHGGLLMSETTKSEPPTSVQSELHIPXTKNKSNGHKTKFGDDKDGX-TLPSGPVKRKRLRPANQKRTAVS-EMSASAQLVLDATGSRCNRKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWFCTASTSKKLPASVGSSAKDFVMALSYCRK 903
            VE  +R+KS +S + G+                     K E     +S+  +   KNK N  K K  D+K     + S   K  +LR   +K+   S E   S Q VLD+  +R +R   PIWF+LVASE+Q G+  LPQI A YLRIKDG+VPVS+IQKYLMKKL+L SE EVEI C GQPVLP+LQ++NLV+LW  TA TS+++PA++GSSAKDFVM L+Y R+
Sbjct:  219 VEVASRSKSFKSNILGSD-------------------AKLETNQVNESDSQVLKIKNKENKRKAKIEDEKSSPYPVSSDTAKPNKLRRIRKKKEPASGESGISPQAVLDSASNRLSR-TGPIWFSLVASENQEGDDPLPQIPASYLRIKDGSVPVSFIQKYLMKKLDLTSETEVEIKCVGQPVLPTLQLYNLVELWLDTAPTSQRIPATIGSSAKDFVMVLAYARR 424          
BLAST of GH720451 vs. Soybean peptides
Match: Glyma03g31610.1|PACid:16252972 ()

HSP 1 Score: 183.341 bits (464), Expect = 2.489e-46
Identity = 99/182 (54.40%), Postives = 126/182 (69.23%), Query Frame = -1
Query:  232 QSELHIPXTKNKSNGHKTKFGDDKDGXTLPSG----PVKRKRLRPANQKRTAVSEMSASAQLVLDATGSRCNRKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWFCTASTSKKLPASVGSSAKDFVMALSYCRK 765
            +S+  +  TKNK N  K K  D+K      S     P K +R+R   +K TA  E   S Q VLD+  +R +R   PIWF+LVASE+Q G+  LPQI A YLRIKDG++ VS+IQKYLMKKL+L SE EVEI C GQPVLP+LQ++NLV+LW   AST +++PA++GSSAKDFVM L+Y RK
Sbjct:  231 ESDSQVQKTKNKENKRKAKIEDEKSSPYPVSSDTAKPNKLRRIR--KKKETASGESGISPQAVLDSASNRLSR-TGPIWFSLVASENQEGDAPLPQIPASYLRIKDGSISVSFIQKYLMKKLDLTSETEVEIKCMGQPVLPTLQLYNLVELWLDMASTPQRIPATIGSSAKDFVMVLAYGRK 409          
BLAST of GH720451 vs. Soybean peptides
Match: Glyma10g03780.1|PACid:16278485 ()

HSP 1 Score: 154.451 bits (389), Expect = 1.238e-37
Identity = 96/212 (45.28%), Postives = 123/212 (58.02%), Query Frame = -1
Query:  226 LAXLESPITPHGGLLMSETTKSEPPTSVQSELHIPXTKNKSNGHKTKFGDDK---DGXTLPSG-PVKRKRLRPANQKRTAVSEMSASAQLVLDATGSRCNRKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWFCTASTSKKLPASVGSSAKDFVMALSYCRKTL 849
            LA   S   P    + +   K E      S+  +   K K    K K  D+K   D  +  +  P K +R+RP  +K     E   S Q VLDAT  R    N  IWF+L ASE+Q G+  LPQI + Y+RIK+G++PVS+IQK LMKKL L SE EVEI C G PVLPSLQ+ NLVD W   A++  ++PA++GSS KDFVM L+Y RK L
Sbjct:  219 LAEAASRSKPFKSNVQASDAKLESMKVTDSDAKVLKAKIKEKKRKAKVEDEKIITDHVSSDTAKPNKLRRVRP--RKEPVFGESRISPQAVLDAT-DRNLLWNDSIWFSLAASENQEGDAPLPQIPSNYVRIKNGSIPVSFIQKLLMKKLGLNSEDEVEIKCMGHPVLPSLQVQNLVDSWLDMAASGHRIPATIGSSGKDFVMILTYGRKVL 427          
BLAST of GH720451 vs. Soybean peptides
Match: Glyma02g15980.1|PACid:16248230 ()

HSP 1 Score: 151.369 bits (381), Expect = 1.048e-36
Identity = 97/211 (45.97%), Postives = 120/211 (56.87%), Query Frame = -1
Query:  226 LAXLESPITPHGGLLMSETTKSEPPTSVQSELHIPXTKNKSNGHKTKFGDDKDGXTLPSGPV-KRKRLRPANQKRTAV-SEMSASAQLVLDATGSRCNRKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLW-FCTASTSKKLPASVGSSAKDFVMALSYCRKTL 849
            LA   S   P    + +   K E      S+  +   K K    K K  ++K      S    K  +LR   QK+  V  E   S Q VLDAT  R    N  IWF+L ASE+Q G+  LPQI + Y+RIK+G++PVS+IQK LMKKL L SE EVEI C G PVLPSLQ+ NLVDLW   TAS   ++ A++GSS KDFVM L+Y RK L
Sbjct:  217 LAEAASRSKPFKSNVQASDAKLESMKMTDSDAKVLKAKIKEKKRKAKVEEEKISTDHASSDTSKPNKLRRVRQKKEPVFGESRISPQAVLDAT-DRNLLWNDSIWFSLAASENQEGDAPLPQIPSNYVRIKNGSIPVSFIQKLLMKKLGLKSEDEVEIKCMGHPVLPSLQVQNLVDLWGVDTASLGHRISATIGSSGKDFVMILTYGRKVL 426          
BLAST of GH720451 vs. Soybean peptides
Match: Glyma10g32360.1|PACid:16280685 ()

HSP 1 Score: 134.42 bits (337), Expect = 1.326e-31
Identity = 86/226 (38.05%), Postives = 123/226 (54.42%), Query Frame = -1
Query:  232 SVEAPNRTKSSRSGLQGTPLAXLESPITPHGGLLMSETTKSEPPTSVQSELHIPXTKNKSNGHKTKFGDDKDGXTLPSGPVKRKRLRPANQKRTAVSE-MSASAQLVLDATGSRCNRKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWFCTASTSKKLPASVGSSAKDFVMALSYCRK 906
            S + P   K   S L+       E    P   L+   + K    +++Q     P  ++  N       D  +     S  V+ +R     +K   +SE ++  AQ  +  +  + N++  PIWF LVA+E++     LPQ+S+ YLR+KDG+V VSYI+KYL+KKL L SEAEVEI  +G+ +L SLQ+ NLVD+W  T      + ASVGSSAKDF+M LSY RK
Sbjct:  209 SSQQPETNKRDNSELRNEMADMFE----PLNSLVEPGSKKPRKKSTMQENTVTPIVRSHDNA-----ADQNESTPSNSDSVQHQRPLRTQEKTFRISEDLNFPAQPEI-GSNIKSNKEFGPIWFCLVAAEEKKASARLPQLSSSYLRVKDGSVTVSYIKKYLVKKLGLGSEAEVEITLQGRALLSSLQLRNLVDMWLQTV-PKNGIQASVGSSAKDFIMVLSYGRK 423          
BLAST of GH720451 vs. Soybean peptides
Match: Glyma20g35250.1|PACid:16317931 ()

HSP 1 Score: 129.028 bits (323), Expect = 5.570e-30
Identity = 84/196 (42.86%), Postives = 116/196 (59.18%), Query Frame = -1
Query:  229 SETTKSEPPTSVQSELHIPXTKNKSNGHKTKFGDDKDGXTLPSGPVKRKRLRP-ANQKRTA-VSE---MSASAQLVLDATGSRCNRKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWFCTASTSKKLPASVGSSAKDFVMALSYCRKT 801
            +ET     P +   E     ++ KS         D++  T PS     +  RP +NQ++T  +SE     A  ++  +  G   N++  PIWF LVA+E++     LPQ+ + YLR+KDG+V VSYI+KYL+KKL LASE EVEI  +G+ +L SLQ+ NLVD+W  T     K+   VGSSAKDF+MALSY RKT
Sbjct:  167 NETADMLEPLNSLVEPGSKKSRKKSTMRSNDNAADQNEST-PSNSDSVQHQRPLSNQEKTLRISEDLNFPAQPEIGSNIEG---NKEFGPIWFCLVAAEEKKASARLPQLYSSYLRVKDGSVTVSYIKKYLVKKLGLASEDEVEITLQGRALLSSLQLRNLVDMWLHTV-PKNKIQTFVGSSAKDFIMALSYGRKT 357          
BLAST of GH720451 vs. SwissProt
Match: DRIP2_ARATH (E3 ubiquitin protein ligase DRIP2 OS=Arabidopsis thaliana GN=DRIP2 PE=1 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 3.443e-38
Identity = 88/188 (46.81%), Postives = 120/188 (63.83%), Query Frame = -1
Query:  232 KSEPPTSVQSELHIPXTKNKSNGHKTKFGDD--KDGXTLPSGPVKRKRLRPANQKRTAVSEMSASAQLVLDATGSRCNRKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWFCTASTSKKLPASVGSSAKDFVMALSYCRK 789
            KSE   +  +++    TK K +  K K  ++   +G    S     KR R   +KR++    S    L+  A   +  R+N  +WF+LVAS +Q GE SLPQI A YLRI+DG +PVS+IQKYLM+KL+L SE EVEI C G+PV+P+LQ+H+LVDLW  T S  +++ AS+GSSAK+FVM L Y RK
Sbjct:  228 KSELGNASHNDVQGSKTKTKDHKRKCKLEEEISNNGDPTTSETATLKRTRRTRRKRSSTFGDSR-IPLLPGAASLKQERRNGHVWFSLVASSNQEGEASLPQIPANYLRIRDGNIPVSFIQKYLMRKLDLKSEDEVEITCMGEPVIPTLQLHSLVDLWLETTSKHQRVAASIGSSAKEFVMVLVYSRK 414          
BLAST of GH720451 vs. SwissProt
Match: DRIP1_ARATH (E3 ubiquitin protein ligase DRIP1 OS=Arabidopsis thaliana GN=DRIP1 PE=1 SV=2)

HSP 1 Score: 155.992 bits (393), Expect = 2.915e-37
Identity = 86/189 (45.50%), Postives = 117/189 (61.90%), Query Frame = -1
Query:  232 TKSEPPTSVQSELHIPXTKNKSNGHKTKFGDDK--DGXTLPSGPVKRKRLRPANQKRTAVSEMSASAQLVLDATGSRCNRKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWFCTASTSKKLPASVGSSAKDFVMALSYCRK 792
            +KSE     +++     TK K+   K K  DDK  +G    S  V  KR+R   +KR+A +   +      D + ++  R+N P+WF+LVAS DQ G  SLPQI A +LRI+DG   VS+IQKYLM+KL+L SE E+EI C G+ V+P+L ++NLVDLW   +S  ++  A VGSSAKDF M L Y RK
Sbjct:  227 SKSEHANVSRNQFQGSKTKTKNKKRKCKREDDKSNNGDPTTSETVTPKRMRTTQRKRSATTLGDSRNLPQPDESSAKQERRNGPVWFSLVASNDQEGGTSLPQIPANFLRIRDGNTTVSFIQKYLMRKLDLESENEIEIKCMGEAVIPTLTLYNLVDLWLQKSSNHQRFAALVGSSAKDFTMVLVYARK 415          
BLAST of GH720451 vs. SwissProt
Match: DRIPH_ARATH (Probable E3 ubiquitin protein ligase DRIPH OS=Arabidopsis thaliana GN=At3g23060 PE=2 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 2.560e-25
Identity = 76/234 (32.48%), Postives = 120/234 (51.28%), Query Frame = -1
Query:  229 DAVDLSVEAPNRTKSSRSGLQGTPLAXLES---PITPHGGLLMSETTKSEPPTSVQSELHIPXTKNKSNGHKTKFGDDKDGXTLPSGPVKRKRLRPANQKRTAVSEMSASAQLVLDATGSRCNRKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWFCTASTSKKLPASVGSSAKDFVMALSYCRKT 921
            D V+  + + + T+ S   +Q   +   E+   P+  +   L+  + +     S Q         ++S   K K   +K     P   + R+ + PA    T  + +S   ++ ++       R N+P+WF+L  S+ QN E+ LP I+AC +R+KD  + VSY++KYLM KL L SE +VEI  R +PV  SL +HNLVD W  T    ++  A VGSSA +F+M L Y  K+
Sbjct:  244 DIVEPEISSDDDTEESVEPIQNKCVVNRETKEVPVQVNQNSLLISSDRDREDNSGQKLKTNGAATSRSRKKKGKKPVEKSYSLRPR--IGRRTVNPAAGTTTPEAPVSVEEEMKVEE-----GRNNNPVWFSLKPSKTQNIEMLLPPITACCIRVKDSNMTVSYLKKYLMVKLGLESEDQVEIWLRDEPVCSSLTLHNLVDWWVQTTPLPERQSAMVGSSAAEFIMDLYYSFKS 470          
BLAST of GH720451 vs. Medicago proteins
Match: IMGA|Medtr1g093150.1 (Unknown Protein (AHRD V1) chr01_pseudomolecule_IMGAG_V3.5 26155119-26152749 H EGN_Mt100125 20100825)

HSP 1 Score: 132.88 bits (333), Expect = 2.165e-31
Identity = 89/203 (43.84%), Postives = 126/203 (62.07%), Query Frame = -1
Query:  232 LMSETT---KSEPPTSVQSELHIPXTKNKSNG---HKTKF----GDDKDGXTLPSGPVKRKRLRPANQ-KRTAVSEMSASAQLVLDATGSRCNRKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEIICRGQPVLPSLQMHNLVDLWFCTASTSKKLPASVGSSAKDFVMALSYCRK 807
            L  ETT   KS   ++VQ    IP   + S+    H +K     GD  +     S  +K K    ANQ KR   SE      L  + +   CN    PIWF+LVAS++Q+   +LPQIS+ Y+ +++G++PVS+I+K+L++KL+LASEAEVEI+ RG+PVL S+Q+ NLV++W  T   ++++  SVGSSAKDFVM LSY RK
Sbjct:  227 LSVETTNKNKSPSNSTVQENGDIPMLVDSSDNDSHHVSKLTEAEGDQIESIPPKSTSLKIKLKSVANQEKRVKFSEDLNLPALAENESKKDCN----PIWFSLVASKEQDVG-ALPQISSPYIMVRNGSLPVSHIKKHLVQKLDLASEAEVEILLRGKPVLCSMQLQNLVEMWLETMPKNERIQTSVGSSAKDFVMVLSYGRK 424          
BLAST of GH720451 vs. Medicago proteins
Match: IMGA|Medtr7g021270.1 (Unknown Protein (AHRD V1) chr07_pseudomolecule_IMGAG_V3.5 5090641-5088875 E EGN_Mt100125 20100825)

HSP 1 Score: 58.9214 bits (141), Expect = 3.973e-9
Identity = 33/61 (54.10%), Postives = 40/61 (65.57%), Query Frame = -1
Query:  379 RKNSPIWFTLVASEDQNGEISLPQISACYLRIKDGTVPVSYIQKYLMKKLNLASEAEVEII 561
            R +S IWF L AS++Q  E  LPQI   YLRIKDG + V  + KYL+ KL L SE+EV  I
Sbjct:  304 RPHSGIWFMLQASQNQLKEPFLPQIPKNYLRIKDGRMTVRLLFKYLVSKLKLESESEVIFI 364          
The following BLAST results are available for this feature:
BLAST of GH720451 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
B9SZ64_RICCO7.455e-6361.50Ring finger protein, putative OS=Ricinus communis ... [more]
B9I5G3_POPTR8.243e-6258.95Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
A5AFM2_VITVI8.827e-5654.09Putative uncharacterized protein OS=Vitis vinifera... [more]
B9MZC8_POPTR4.843e-5461.54Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
D7TXF2_VITVI1.193e-5252.19Whole genome shotgun sequence of line PN40024, sca... [more]
D7SQL7_VITVI7.490e-4749.56Whole genome shotgun sequence of line PN40024, sca... [more]
B9HUN4_POPTR5.934e-4446.58Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
B9HKE2_POPTR1.909e-4245.78Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
D7T790_VITVI2.111e-4145.37Whole genome shotgun sequence of line PN40024, sca... [more]
B9GS64_POPTR6.141e-4145.13Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
back to top
BLAST of GH720451 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Swissprot)
Total hits: 3
Match NameE-valueIdentityDescription
DRIP2_ARATH3.382e-3846.81E3 ubiquitin protein ligase DRIP2 OS=Arabidopsis t... [more]
DRIP1_ARATH2.863e-3745.50E3 ubiquitin protein ligase DRIP1 OS=Arabidopsis t... [more]
DRIPH_ARATH2.514e-2532.48Probable E3 ubiquitin protein ligase DRIPH OS=Arab... [more]
back to top
BLAST of GH720451 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide)
Total hits: 6
Match NameE-valueIdentityDescription
AT2G30580.13.290e-3946.81| Symbols: DRIP2 | DREB2A-interacting protein 2 | ... [more]
AT1G06770.22.785e-3845.50| Symbols: DRIP1 | DREB2A-interacting protein 1 | ... [more]
AT1G06770.12.785e-3845.50| Symbols: DRIP1 | DREB2A-interacting protein 1 | ... [more]
AT3G23060.12.446e-2632.48| Symbols: | RING/U-box superfamily protein | chr... [more]
AT5G13250.15.651e-1543.86| Symbols: | RING finger protein | chr5:4234486-4... [more]
AT1G28080.11.440e-1055.00| Symbols: | RING finger protein | chr1:9789826-9... [more]
back to top
BLAST of GH720451 vs. TAIR peptide
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs TAIR 10 peptide)
Total hits: 6
Match NameE-valueIdentityDescription
AT2G30580.13.290e-3946.81| Symbols: DRIP2 | DREB2A-interacting protein 2 | ... [more]
AT1G06770.22.785e-3845.50| Symbols: DRIP1 | DREB2A-interacting protein 1 | ... [more]
AT1G06770.12.785e-3845.50| Symbols: DRIP1 | DREB2A-interacting protein 1 | ... [more]
AT3G23060.12.446e-2632.48| Symbols: | RING/U-box superfamily protein | chr... [more]
AT5G13250.15.651e-1543.86| Symbols: | RING finger protein | chr5:4234486-4... [more]
AT1G28080.11.440e-1055.00| Symbols: | RING finger protein | chr1:9789826-9... [more]
back to top
BLAST of GH720451 vs. TrEMBL
Analysis Date: 2011-04-27 (Homology Analysis: Pisum sativum unigene v2 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
B9SZ64_RICCO9.114e-6361.50Ring finger protein, putative OS=Ricinus communis ... [more]
B9I5G3_POPTR1.008e-6158.95Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
A5AFM2_VITVI1.079e-5554.09Putative uncharacterized protein OS=Vitis vinifera... [more]
B9MZC8_POPTR5.921e-5461.54Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
D7TXF2_VITVI1.458e-5252.19Whole genome shotgun sequence of line PN40024, sca... [more]
D7SQL7_VITVI9.157e-4749.56Whole genome shotgun sequence of line PN40024, sca... [more]
B9HUN4_POPTR7.255e-4446.58Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
B9HKE2_POPTR2.334e-4245.78Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
D7T790_VITVI2.580e-4145.37Whole genome shotgun sequence of line PN40024, sca... [more]
B9GS64_POPTR7.508e-4145.13Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
back to top
BLAST of GH720451 vs. Lotus protein
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Lotus proteins)
Total hits: 4
Match NameE-valueIdentityDescription
chr5.LjT29J15.30.r2.m1.202e-8671.11- phase: 0 /partial[more]
chr1.CM0375.430.r2.d1.486e-4444.98- phase: 0 [more]
chr5.CM0071.540.r2.m3.435e-3352.17- phase: 0 /partial[more]
LjSGA_030015.17.412e-2872.50- phase: 2 /partial[more]
back to top
BLAST of GH720451 vs. Soybean peptides
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Soybean peptides)
Total hits: 8
Match NameE-valueIdentityDescription
Glyma10g30510.1|PACid:162804751.537e-9677.19[more]
Glyma20g36830.1|PACid:163181139.718e-6783.67[more]
Glyma19g34440.1|PACid:163137341.905e-4647.35[more]
Glyma03g31610.1|PACid:162529722.489e-4654.40[more]
Glyma10g03780.1|PACid:162784851.238e-3745.28[more]
Glyma02g15980.1|PACid:162482301.048e-3645.97[more]
Glyma10g32360.1|PACid:162806851.326e-3138.05[more]
Glyma20g35250.1|PACid:163179315.570e-3042.86[more]
back to top
BLAST of GH720451 vs. SwissProt
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Swissprot)
Total hits: 3
Match NameE-valueIdentityDescription
DRIP2_ARATH3.443e-3846.81E3 ubiquitin protein ligase DRIP2 OS=Arabidopsis t... [more]
DRIP1_ARATH2.915e-3745.50E3 ubiquitin protein ligase DRIP1 OS=Arabidopsis t... [more]
DRIPH_ARATH2.560e-2532.48Probable E3 ubiquitin protein ligase DRIPH OS=Arab... [more]
back to top
BLAST of GH720451 vs. Medicago proteins
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Medicago proteins)
Total hits: 2
Match NameE-valueIdentityDescription
IMGA|Medtr1g093150.12.165e-3143.84Unknown Protein (AHRD V1) chr01_pseudomolecule_IMG... [more]
IMGA|Medtr7g021270.13.973e-954.10Unknown Protein (AHRD V1) chr07_pseudomolecule_IMG... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v2
Date Performed: 2011-04-27
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR10825RING FINGER PROTEINcoord: 62..232
score: 2.7
NoneNo IPR availablePANTHERPTHR10825:SF1RING FINGER PROTEINcoord: 62..232
score: 2.7
NoneNo IPR availableSEGsegsegcoord: 5..24
score

Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR10825RING FINGER PROTEINcoord: 62..232
score: 2.7
NoneNo IPR availablePANTHERPTHR10825:SF1RING FINGER PROTEINcoord: 62..232
score: 2.7
NoneNo IPR availableSEGsegsegcoord: 5..24
score

Properties
Property NameValue
Singlet in analysisPisum sativum unigene v2
Singlet in analysisPisum sativum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>GH720451 ID=GH720451|Name=GH720451|organism=Pisum sativum|type=EST|length=924bp
TTCGAGCGGCCGCCCGGNGCAGGTACAAAATTGGGAGGGTATACATTTCA
ACATTATGAGAAACAAATCAAAAACATCCATAACATAGAAGAAATTAATG
AACAATTTCCAAATTAGGAAAACCAAACACCTGAGTTTTGTCCCAAGTAG
TTGTATATCTATGTAAAGTAACAAAAGACCACATAATATGAATAGATATA
GGATAGGGAAACTATCTCAAACAGGTAAGGTCTTTCGACAATACGATAAA
GCCATCACAAAGTCCTTAGCCGAAGATCCTACAGATGCCGGTAGCTTTTT
CGATGTTGATGCTGTGCAGAACCACAGATCTACTAAGTTATGCATTTGCA
AAGATGGGAGCACCGGCTGACCCCGACATATTATTTCCACCTCTGCTTCG
CTTGCGAGATTAAGTTTCTTCATGAGGTACTTTTGAATATACGAGACGGG
CACAGTACCATCCTTTATTCTTAGATAGCAAGCCGAGATCTGTGGCAAGG
AAATTTCTCCGTTCTGGTCTTCTGAAGCAACTAATGTAAACCAAATAGGA
CTGTTTTTCCTGTTGCACCTGCTCCCTGTTGCATCTAACACGAGTTGTGC
TGAGGCAGACATCTCAGACACTGCTGTTCTTTTCTGATTAGCAGGACGCA
GCCTTTTTCGTTTCACTGGTCCCGAAGGCAAGGTGTNTCCGTCCTTGTCA
TCTCCAAACTTTGTTTTATGTCCGTTACTCTTGTTCTTGGTTTNTGGAAT
GTGTAATTCACTCTGAACAGATGTAGGTGGCTCTGACTTGGTAGTTTCAG
ACATCAGTAATCCACCGTGAGGAGTAATCGGGGACTCTAGTNTGGCAAGA
GGAGTCCCTTGTAAACCTGACCTCGAGGACTTTGTTCTATTGGGCGCTTC
AACAGACAGGTCAACGGCGTCCAG
back to top