GH720521

EST Overview
NameGH720521
Unique NameGH720521
TypeEST
OrganismPisum sativum (pea)
Sequence length398
Libraries
Library NameType
LIBEST_024271 552NIcdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Pisum sativum unigene v1Pisum sativum unigene v1EST
Homology
BLAST of GH720521 vs. TrEMBL
Match: B9HLN0_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_1084309 PE=4 SV=1)

HSP 1 Score: 221.476 bits (563), Expect = 2.173e-56
Identity = 99/120 (82.50%), Postives = 110/120 (91.67%), Query Frame = -2
Query:   20 TERYSNLYFNRPDVQKALHANVTGIPYTWKTCSDIVGNFWTDSPLSMLPIYHELINASLRIWVFSGDTDAVVPLTATRYSIDALKLPTVVNWYPWYNSGKVGGWSQVYKGLTFVTVPAXG 379
            TERYS +YFN P+VQKALHANVTGIPY WKTCSDIVG++W DSPLSMLPIY ELI A LRIWV+SGDTDAVVP+TATRYSIDALKLPT++NWYPWY++GKVGGWSQVYKGL+FVTV   G
Sbjct:  312 TERYSKVYFNHPEVQKALHANVTGIPYPWKTCSDIVGDYWADSPLSMLPIYKELIAAGLRIWVYSGDTDAVVPVTATRYSIDALKLPTIINWYPWYDNGKVGGWSQVYKGLSFVTVTGAG 431          
BLAST of GH720521 vs. TrEMBL
Match: B9HU47_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_724942 PE=4 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 4.840e-56
Identity = 99/120 (82.50%), Postives = 110/120 (91.67%), Query Frame = -2
Query:   20 TERYSNLYFNRPDVQKALHANVTGIPYTWKTCSDIVGNFWTDSPLSMLPIYHELINASLRIWVFSGDTDAVVPLTATRYSIDALKLPTVVNWYPWYNSGKVGGWSQVYKGLTFVTVPAXG 379
            TERYS +YFNRP+VQKALHANVTGIPY W+TCS+IVG++W DSPLSMLPIY ELI A LRIWV+SGDTDAVVP+TATRYSIDALKLPT++NWYPWY+SGKVGGWSQVY GLTFVTV   G
Sbjct:  312 TERYSKVYFNRPEVQKALHANVTGIPYPWETCSNIVGDYWADSPLSMLPIYKELIAAGLRIWVYSGDTDAVVPVTATRYSIDALKLPTIINWYPWYDSGKVGGWSQVYTGLTFVTVTGAG 431          
BLAST of GH720521 vs. TrEMBL
Match: D7L738_ARALY (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_478140 PE=4 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 1.009e-53
Identity = 95/120 (79.17%), Postives = 105/120 (87.50%), Query Frame = -2
Query:   20 TERYSNLYFNRPDVQKALHANVTGIPYTWKTCSDIVGNFWTDSPLSMLPIYHELINASLRIWVFSGDTDAVVPLTATRYSIDALKLPTVVNWYPWYNSGKVGGWSQVYKGLTFVTVPAXG 379
            TERYSN+YFNR DVQKALHANVT +PY WK CSDIVG++W DSPLSMLPIY ELI A L+IW+FSGDTDAVVP+TATRYS+DALKL T+ NWYPWY+ GKVGGWSQVYKGLT VTV   G
Sbjct:  310 TERYSNVYFNRADVQKALHANVTRLPYPWKACSDIVGSYWEDSPLSMLPIYRELITAGLKIWIFSGDTDAVVPVTATRYSVDALKLATITNWYPWYDHGKVGGWSQVYKGLTLVTVAGAG 429          
BLAST of GH720521 vs. TrEMBL
Match: Q5QLC0_ORYSJ (Os01g0833500 protein OS=Oryza sativa subsp. japonica GN=P0460C04.22 PE=2 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 2.248e-53
Identity = 94/120 (78.33%), Postives = 107/120 (89.17%), Query Frame = -2
Query:   20 TERYSNLYFNRPDVQKALHANVTGIPYTWKTCSDIVGNFWTDSPLSMLPIYHELINASLRIWVFSGDTDAVVPLTATRYSIDALKLPTVVNWYPWYNSGKVGGWSQVYKGLTFVTVPAXG 379
            TERYS++Y+NRP+VQ A+HAN TGI Y+WKTCSDIVG++W DSP SMLPIY ELI A +RIWVFSGDTDAVVP+TATRYSIDALKLPT+VNWYPWY+ GKVGGWSQVYKGLT VT+   G
Sbjct:  308 TERYSSIYYNRPEVQIAMHANTTGIQYSWKTCSDIVGSYWADSPKSMLPIYQELIAAGIRIWVFSGDTDAVVPVTATRYSIDALKLPTMVNWYPWYDHGKVGGWSQVYKGLTLVTIAGAG 427          
BLAST of GH720521 vs. TrEMBL
Match: A2WWP2_ORYSI (Putative uncharacterized protein OS=Oryza sativa subsp. indica GN=OsI_04319 PE=4 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 2.248e-53
Identity = 94/120 (78.33%), Postives = 107/120 (89.17%), Query Frame = -2
Query:   20 TERYSNLYFNRPDVQKALHANVTGIPYTWKTCSDIVGNFWTDSPLSMLPIYHELINASLRIWVFSGDTDAVVPLTATRYSIDALKLPTVVNWYPWYNSGKVGGWSQVYKGLTFVTVPAXG 379
            TERYS++Y+NRP+VQ A+HAN TGI Y+WKTCSDIVG++W DSP SMLPIY ELI A +RIWVFSGDTDAVVP+TATRYSIDALKLPT+VNWYPWY+ GKVGGWSQVYKGLT VT+   G
Sbjct:  308 TERYSSIYYNRPEVQIAMHANTTGIQYSWKTCSDIVGSYWADSPKSMLPIYQELIAAGIRIWVFSGDTDAVVPVTATRYSIDALKLPTLVNWYPWYDHGKVGGWSQVYKGLTLVTIAGAG 427          
BLAST of GH720521 vs. TrEMBL
Match: C5XP10_SORBI (Putative uncharacterized protein Sb03g038940 OS=Sorghum bicolor GN=Sb03g038940 PE=4 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 3.247e-52
Identity = 91/120 (75.83%), Postives = 106/120 (88.33%), Query Frame = -2
Query:   20 TERYSNLYFNRPDVQKALHANVTGIPYTWKTCSDIVGNFWTDSPLSMLPIYHELINASLRIWVFSGDTDAVVPLTATRYSIDALKLPTVVNWYPWYNSGKVGGWSQVYKGLTFVTVPAXG 379
            TERY+++Y+NRP+VQ A+HAN TG+ Y W+TCSDIVG++W DSP SMLPIY ELI A ++IWVFSGDTDAVVP+TATRYSIDALKLPTVVNWYPWY+ GKVGGWSQVYKGLT VT+   G
Sbjct:  321 TERYASIYYNRPEVQMAMHANTTGLHYPWQTCSDIVGSYWADSPRSMLPIYQELIAAGIKIWVFSGDTDAVVPVTATRYSIDALKLPTVVNWYPWYDHGKVGGWSQVYKGLTLVTIAGAG 440          
BLAST of GH720521 vs. TrEMBL
Match: C4IZC7_MAIZE (Putative uncharacterized protein OS=Zea mays PE=2 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 3.247e-52
Identity = 91/120 (75.83%), Postives = 106/120 (88.33%), Query Frame = -2
Query:   20 TERYSNLYFNRPDVQKALHANVTGIPYTWKTCSDIVGNFWTDSPLSMLPIYHELINASLRIWVFSGDTDAVVPLTATRYSIDALKLPTVVNWYPWYNSGKVGGWSQVYKGLTFVTVPAXG 379
            TERY+++Y+NRP+VQ ALHAN TGI Y W+TCSDIVG++W DSP SMLPIY ELI A ++IWVFSGDTDAVVP+TATRYSIDALKLPT+VNWYPWY+ GKVGGWSQVYKGLT +T+   G
Sbjct:  321 TERYASIYYNRPEVQMALHANTTGIHYPWQTCSDIVGSYWADSPRSMLPIYQELIAAGIKIWVFSGDTDAVVPVTATRYSIDALKLPTLVNWYPWYDHGKVGGWSQVYKGLTLITIAGAG 440          
BLAST of GH720521 vs. TrEMBL
Match: B6U5U4_MAIZE (Virulence-related protein Nf314 OS=Zea mays PE=2 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 3.247e-52
Identity = 91/120 (75.83%), Postives = 106/120 (88.33%), Query Frame = -2
Query:   20 TERYSNLYFNRPDVQKALHANVTGIPYTWKTCSDIVGNFWTDSPLSMLPIYHELINASLRIWVFSGDTDAVVPLTATRYSIDALKLPTVVNWYPWYNSGKVGGWSQVYKGLTFVTVPAXG 379
            TERY+++Y+NRP+VQ ALHAN TGI Y W+TCSDIVG++W DSP SMLPIY ELI A ++IWVFSGDTDAVVP+TATRYSIDALKLPT+VNWYPWY+ GKVGGWSQVYKGLT +T+   G
Sbjct:  321 TERYASIYYNRPEVQMALHANTTGIHYPWQTCSDIVGSYWADSPRSMLPIYQELIAAGIKIWVFSGDTDAVVPVTATRYSIDALKLPTLVNWYPWYDHGKVGGWSQVYKGLTLITIAGAG 440          
BLAST of GH720521 vs. TrEMBL
Match: D7TMB8_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_19.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00016307001 PE=4 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 7.997e-51
Identity = 93/120 (77.50%), Postives = 103/120 (85.83%), Query Frame = -2
Query:   20 TERYSNLYFNRPDVQKALHANVTGIPYTWKTCSDIVGNFWTDSPLSMLPIYHELINASLRIWVFSGDTDAVVPLTATRYSIDALKLPTVVNWYPWYNSGKVGGWSQVYKGLTFVTVPAXG 379
            TERYS +YFN P+VQ ALHANVT + Y W+TCS+IVG +W DSPLSMLPIY ELI A LRIWVFSGDTDAVVP+TATRYSIDALKLPT+ NWY WY++ KVGGWSQVYKGLTFVTV   G
Sbjct:  311 TERYSEVYFNLPEVQTALHANVTQVSYPWRTCSNIVGIYWADSPLSMLPIYQELIAAGLRIWVFSGDTDAVVPVTATRYSIDALKLPTITNWYAWYDNHKVGGWSQVYKGLTFVTVTGAG 430          
BLAST of GH720521 vs. TrEMBL
Match: A5BPW0_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_028701 PE=4 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 7.997e-51
Identity = 93/120 (77.50%), Postives = 103/120 (85.83%), Query Frame = -2
Query:   20 TERYSNLYFNRPDVQKALHANVTGIPYTWKTCSDIVGNFWTDSPLSMLPIYHELINASLRIWVFSGDTDAVVPLTATRYSIDALKLPTVVNWYPWYNSGKVGGWSQVYKGLTFVTVPAXG 379
            TERYS +YFN P+VQ ALHANVT + Y W+TCS+IVG +W DSPLSMLPIY ELI A LRIWVFSGDTDAVVP+TATRYSIDALKLPT+ NWY WY++ KVGGWSQVYKGLTFVTV   G
Sbjct:  307 TERYSEVYFNLPEVQTALHANVTQVSYPWRTCSNIVGIYWADSPLSMLPIYQELIAAGLRIWVFSGDTDAVVPVTATRYSIDALKLPTITNWYXWYDNHKVGGWSQVYKGLTFVTVTGAG 426          
BLAST of GH720521 vs. SwissProt
Match: SCP27_ARATH (Serine carboxypeptidase-like 27 OS=Arabidopsis thaliana GN=SCPL27 PE=2 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 5.481e-54
Identity = 95/120 (79.17%), Postives = 104/120 (86.67%), Query Frame = -2
Query:   20 TERYSNLYFNRPDVQKALHANVTGIPYTWKTCSDIVGNFWTDSPLSMLPIYHELINASLRIWVFSGDTDAVVPLTATRYSIDALKLPTVVNWYPWYNSGKVGGWSQVYKGLTFVTVPAXG 379
            TERYSN+YFNR DVQKALHANVT + Y WK CSDIVG++W DSPLSMLPIY ELI A L+IWVFSGDTDAVVP+TATRYS+DALKL T+ NWYPWY+ GKVGGWSQVYKGLT VTV   G
Sbjct:  313 TERYSNVYFNRLDVQKALHANVTRLSYPWKACSDIVGSYWDDSPLSMLPIYKELITAGLKIWVFSGDTDAVVPITATRYSVDALKLATITNWYPWYDHGKVGGWSQVYKGLTLVTVAGAG 432          
BLAST of GH720521 vs. SwissProt
Match: SCP26_ARATH (Serine carboxypeptidase-like 26 OS=Arabidopsis thaliana GN=SCPL26 PE=2 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 1.001e-47
Identity = 85/120 (70.83%), Postives = 97/120 (80.83%), Query Frame = -2
Query:   20 TERYSNLYFNRPDVQKALHANVTGIPYTWKTCSDIVGNFWTDSPLSMLPIYHELINASLRIWVFSGDTDAVVPLTATRYSIDALKLPTVVNWYPWYNSGKVGGWSQVYKGLTFVTVPAXG 379
            TE+YS +YFN P+VQKA+HAN+TG+ Y WK CSDIVG  W DSPLSMLPIY ELI A LRIWVFSGDTD+VVP+T TRYSI ALKL  +  WYPW + G+VGGWSQVYKGLT VT+   G
Sbjct:  307 TEKYSGMYFNSPEVQKAMHANITGLAYPWKGCSDIVGEKWADSPLSMLPIYKELIAAGLRIWVFSGDTDSVVPITGTRYSIRALKLQPLSKWYPWNDDGQVGGWSQVYKGLTLVTIHGAG 426          
BLAST of GH720521 vs. SwissProt
Match: CBP21_HORVU (Serine carboxypeptidase II-1 (Fragment) OS=Hordeum vulgare GN=CXP;2-1 PE=1 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 3.805e-47
Identity = 85/126 (67.46%), Postives = 97/126 (76.98%), Query Frame = -2
Query:   20 RGRGRGTERYSNLYFNRPDVQKALHANVTGIPYTWKTCSDIVGNFWTDSPLSMLPIYHELINASLRIWVFSGDTDAVVPLTATRYSIDALKLPTVVNWYPWYNSGKVGGWSQVYKGLTFVTVPAXG 397
            RG    TE+YS  Y+N P+VQKA  ANVTGIPY+W  CSD++ + W DSP SMLPIY ELI A +RIWVFSGD D+VVPLTATRYSIDAL LPTV NWYPWY+  +V GW QVYKGLT VT+   G
Sbjct:  165 RGYDPCTEQYSTKYYNLPEVQKAFRANVTGIPYSWTACSDVLSDHWKDSPRSMLPIYRELIAAGIRIWVFSGDADSVVPLTATRYSIDALYLPTVTNWYPWYDEEEVAGWCQVYKGLTLVTIRGAG 290          
BLAST of GH720521 vs. SwissProt
Match: CBP2_WHEAT (Serine carboxypeptidase 2 OS=Triticum aestivum GN=CBP2 PE=1 SV=2)

HSP 1 Score: 182.57 bits (462), Expect = 5.494e-46
Identity = 87/121 (71.90%), Postives = 95/121 (78.51%), Query Frame = -2
Query:   20 TERYSNLYFNRPDVQKALHANVTG-IPYTWKTCSDIVGNFWTDSPLSMLPIYHELINASLRIWVFSGDTDAVVPLTATRYSIDALKLPTVVNWYPWYNSGKVGGWSQVYKGLTFVTVPAXG 379
            TERYS  Y+NR DVQ ALHANVTG + YTW TCSD +   W D+P SMLPIY ELI A LRIWVFSGDTDAVVPLTATRYSI AL LPT  +WYPWY+  +VGGWSQVYKGLT V+V   G
Sbjct:  292 TERYSTAYYNRRDVQMALHANVTGAMNYTWATCSDTINTHWHDAPRSMLPIYRELIAAGLRIWVFSGDTDAVVPLTATRYSIGALGLPTTTSWYPWYDDQEVGGWSQVYKGLTLVSVRGAG 412          
BLAST of GH720521 vs. SwissProt
Match: CBP2_HORVU (Serine carboxypeptidase 2 OS=Hordeum vulgare GN=CBP2 PE=1 SV=2)

HSP 1 Score: 172.94 bits (437), Expect = 4.353e-43
Identity = 85/122 (69.67%), Postives = 93/122 (76.23%), Query Frame = -2
Query:   20 TERYSNLYFNRPDVQKALHANVTG-IPYTWKTCSDIVGNFWTDSPLSMLPIYHELINASLRIWVFSGDTDAVVPLTATRYSIDALKLPTVVNWYPWYNS-GKVGGWSQVYKGLTFVTVPAXG 379
            TERYS  Y+NR DVQ ALHANVTG + YTW  CSD +   W D+P SMLPIY ELI A LRIWVFSGDTDAVVPLTATRYSI AL L T  +WYPWY+   +VGGWSQVYKGLT V+V   G
Sbjct:  321 TERYSTAYYNRRDVQTALHANVTGAMNYTWTNCSDTINTHWHDAPRSMLPIYRELIAAGLRIWVFSGDTDAVVPLTATRYSIGALGLATTTSWYPWYDDLQEVGGWSQVYKGLTLVSVRGAG 442          
BLAST of GH720521 vs. SwissProt
Match: SCP24_ARATH (Serine carboxypeptidase 24 OS=Arabidopsis thaliana GN=SCPL24 PE=1 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 6.286e-42
Identity = 74/120 (61.67%), Postives = 89/120 (74.17%), Query Frame = -2
Query:   20 TERYSNLYFNRPDVQKALHANVTGIPYTWKTCSDIVGNFWTDSPLSMLPIYHELINASLRIWVFSGDTDAVVPLTATRYSIDALKLPTVVNWYPWYNSGKVGGWSQVYKGLTFVTVPAXG 379
            TE Y+  YFNRPDVQ+A+HANVTGI Y W  CSD++   W DS  +MLPIY EL  + LRIW+FSGDTD+VVP+TATR+S+  L LP    WYPWY   +VGGW++VYKGLTF TV   G
Sbjct:  318 TESYAEKYFNRPDVQRAMHANVTGIRYKWTACSDVLIKTWKDSDKTMLPIYKELAASGLRIWIFSGDTDSVVPVTATRFSLSHLNLPVKTRWYPWYTDNQVGGWTEVYKGLTFATVRGAG 437          
BLAST of GH720521 vs. SwissProt
Match: SCP23_ARATH (Putative serine carboxypeptidase-like 23 OS=Arabidopsis thaliana GN=SCPL23 PE=2 SV=2)

HSP 1 Score: 166.777 bits (421), Expect = 3.120e-41
Identity = 72/120 (60.00%), Postives = 89/120 (74.17%), Query Frame = -2
Query:   20 TERYSNLYFNRPDVQKALHANVTGIPYTWKTCSDIVGNFWTDSPLSMLPIYHELINASLRIWVFSGDTDAVVPLTATRYSIDALKLPTVVNWYPWYNSGKVGGWSQVYKGLTFVTVPAXG 379
            TE Y+ +Y+NRPDVQ+A+HAN+T IPY W  C+ +V N W DS  SMLPIY EL  A LRIWVFSGDTDAVVP+T TR ++  L LP    WYPWY+  +VGGW++VY+GLTF T+   G
Sbjct:  307 TESYAEIYYNRPDVQRAMHANLTSIPYKWTLCNMVVNNNWKDSEFSMLPIYKELTAAGLRIWVFSGDTDAVVPVTGTRLALSKLNLPVKTPWYPWYSEKQVGGWTEVYEGLTFATIRGAG 426          
BLAST of GH720521 vs. SwissProt
Match: SCP25_ARATH (Serine carboxypeptidase-like 25 OS=Arabidopsis thaliana GN=SCPL25 PE=2 SV=2)

HSP 1 Score: 166.007 bits (419), Expect = 5.321e-41
Identity = 71/120 (59.17%), Postives = 91/120 (75.83%), Query Frame = -2
Query:   20 TERYSNLYFNRPDVQKALHANVTGIPYTWKTCSDIVGNFWTDSPLSMLPIYHELINASLRIWVFSGDTDAVVPLTATRYSIDALKLPTVVNWYPWYNSGKVGGWSQVYKGLTFVTVPAXG 379
            TERY+ +Y+NRPDVQKALHAN T IPY W  CS+++   W D+  ++LPIY E+I   +R+WVFSGD D+VVP+TATRYS+  L L T + WYPWY   +VGGW++VY+GLTFVTV   G
Sbjct:  327 TERYAEIYYNRPDVQKALHANTTKIPYKWTACSEVLNRNWNDTDSTVLPIYREMIAGGIRVWVFSGDVDSVVPVTATRYSLARLSLSTKLPWYPWYVKKQVGGWTEVYEGLTFVTVRGAG 446          
BLAST of GH720521 vs. SwissProt
Match: SCP22_ARATH (Serine carboxypeptidase-like 22 OS=Arabidopsis thaliana GN=SCPL22 PE=2 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 4.980e-39
Identity = 74/122 (60.66%), Postives = 90/122 (73.77%), Query Frame = -2
Query:   20 TERYSNLYFNRPDVQKALHANVTGIPYTWKTCSDIVGNFWT--DSPLSMLPIYHELINASLRIWVFSGDTDAVVPLTATRYSIDALKLPTVVNWYPWYNSGKVGGWSQVYKGLTFVTVPAXG 379
            TE Y+ +Y+NRP+VQ+A+HAN T IPY W  CSD V N W   DS  SMLPIY ELI A LRIWV+SGDTD+V+P+TATRYS+  L L     WYPWY+  +VGG ++VY+GLTFVTV   G
Sbjct:  315 TENYAEIYYNRPEVQRAMHANHTAIPYKWTACSDSVFNNWNWRDSDNSMLPIYKELIAAGLRIWVYSGDTDSVIPVTATRYSLGKLNLRVKTRWYPWYSGNQVGGRTEVYEGLTFVTVRGAG 436          
BLAST of GH720521 vs. SwissProt
Match: SCP29_ARATH (Serine carboxypeptidase-like 29 OS=Arabidopsis thaliana GN=SCPL29 PE=2 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 9.393e-38
Identity = 74/120 (61.67%), Postives = 86/120 (71.67%), Query Frame = -2
Query:   20 TERYSNLYFNRPDVQKALHANVTGIPYTWKTCSDIVGNFWTDSPLSMLPIYHELINASLRIWVFSGDTDAVVPLTATRYSIDALKLPTVVNWYPWYNSGKVGGWSQVYKGLTFVTVPAXG 379
            TE+++ +YFN P+VQKALH      P  W TCSD+V   W DSP S+L IYHELI A LRIWVFSGD DAVVP+T+TRYSIDAL L  +  + PWY  G+VGGWSQ Y GL FVTV   G
Sbjct:  318 TEKHTTVYFNLPEVQKALHVPPGLAPSKWDTCSDVVSEHWNDSPSSVLNIYHELIAAGLRIWVFSGDADAVVPVTSTRYSIDALNLRPLSAYGPWYLDGQVGGWSQQYAGLNFVTVRGAG 437          
BLAST of GH720521 vs. TAIR peptide
Match: AT3G07990.1 (| Symbols: SCPL27 | serine carboxypeptidase-like 27 | chr3:2552544-2554644 FORWARD LENGTH=459)

HSP 1 Score: 209.149 bits (531), Expect = 5.935e-55
Identity = 95/120 (79.17%), Postives = 104/120 (86.67%), Query Frame = -2
Query:   20 TERYSNLYFNRPDVQKALHANVTGIPYTWKTCSDIVGNFWTDSPLSMLPIYHELINASLRIWVFSGDTDAVVPLTATRYSIDALKLPTVVNWYPWYNSGKVGGWSQVYKGLTFVTVPAXG 379
            TERYSN+YFNR DVQKALHANVT + Y WK CSDIVG++W DSPLSMLPIY ELI A L+IWVFSGDTDAVVP+TATRYS+DALKL T+ NWYPWY+ GKVGGWSQVYKGLT VTV   G
Sbjct:  313 TERYSNVYFNRLDVQKALHANVTRLSYPWKACSDIVGSYWDDSPLSMLPIYKELITAGLKIWVFSGDTDAVVPITATRYSVDALKLATITNWYPWYDHGKVGGWSQVYKGLTLVTVAGAG 432          
BLAST of GH720521 vs. TAIR peptide
Match: AT2G35780.1 (| Symbols: scpl26 | serine carboxypeptidase-like 26 | chr2:15037733-15040104 REVERSE LENGTH=452)

HSP 1 Score: 188.348 bits (477), Expect = 1.084e-48
Identity = 85/120 (70.83%), Postives = 97/120 (80.83%), Query Frame = -2
Query:   20 TERYSNLYFNRPDVQKALHANVTGIPYTWKTCSDIVGNFWTDSPLSMLPIYHELINASLRIWVFSGDTDAVVPLTATRYSIDALKLPTVVNWYPWYNSGKVGGWSQVYKGLTFVTVPAXG 379
            TE+YS +YFN P+VQKA+HAN+TG+ Y WK CSDIVG  W DSPLSMLPIY ELI A LRIWVFSGDTD+VVP+T TRYSI ALKL  +  WYPW + G+VGGWSQVYKGLT VT+   G
Sbjct:  307 TEKYSGMYFNSPEVQKAMHANITGLAYPWKGCSDIVGEKWADSPLSMLPIYKELIAAGLRIWVFSGDTDSVVPITGTRYSIRALKLQPLSKWYPWNDDGQVGGWSQVYKGLTLVTIHGAG 426          
BLAST of GH720521 vs. TAIR peptide
Match: AT4G30610.1 (| Symbols: BRS1, SCPL24 | alpha/beta-Hydrolases superfamily protein | chr4:14944219-14948391 FORWARD LENGTH=465)

HSP 1 Score: 169.088 bits (427), Expect = 6.806e-43
Identity = 74/120 (61.67%), Postives = 89/120 (74.17%), Query Frame = -2
Query:   20 TERYSNLYFNRPDVQKALHANVTGIPYTWKTCSDIVGNFWTDSPLSMLPIYHELINASLRIWVFSGDTDAVVPLTATRYSIDALKLPTVVNWYPWYNSGKVGGWSQVYKGLTFVTVPAXG 379
            TE Y+  YFNRPDVQ+A+HANVTGI Y W  CSD++   W DS  +MLPIY EL  + LRIW+FSGDTD+VVP+TATR+S+  L LP    WYPWY   +VGGW++VYKGLTF TV   G
Sbjct:  318 TESYAEKYFNRPDVQRAMHANVTGIRYKWTACSDVLIKTWKDSDKTMLPIYKELAASGLRIWIFSGDTDSVVPVTATRFSLSHLNLPVKTRWYPWYTDNQVGGWTEVYKGLTFATVRGAG 437          
BLAST of GH720521 vs. TAIR peptide
Match: AT2G24010.1 (| Symbols: scpl23 | serine carboxypeptidase-like 23 | chr2:10214714-10217542 FORWARD LENGTH=440)

HSP 1 Score: 166.777 bits (421), Expect = 3.378e-42
Identity = 72/120 (60.00%), Postives = 89/120 (74.17%), Query Frame = -2
Query:   20 TERYSNLYFNRPDVQKALHANVTGIPYTWKTCSDIVGNFWTDSPLSMLPIYHELINASLRIWVFSGDTDAVVPLTATRYSIDALKLPTVVNWYPWYNSGKVGGWSQVYKGLTFVTVPAXG 379
            TE Y+ +Y+NRPDVQ+A+HAN+T IPY W  C+ +V N W DS  SMLPIY EL  A LRIWVFSGDTDAVVP+T TR ++  L LP    WYPWY+  +VGGW++VY+GLTF T+   G
Sbjct:  293 TESYAEIYYNRPDVQRAMHANLTSIPYKWTLCNMVVNNNWKDSEFSMLPIYKELTAAGLRIWVFSGDTDAVVPVTGTRLALSKLNLPVKTPWYPWYSEKQVGGWTEVYEGLTFATIRGAG 412          
BLAST of GH720521 vs. TAIR peptide
Match: AT3G02110.1 (| Symbols: scpl25 | serine carboxypeptidase-like 25 | chr3:370902-373637 REVERSE LENGTH=473)

HSP 1 Score: 166.007 bits (419), Expect = 5.762e-42
Identity = 71/120 (59.17%), Postives = 91/120 (75.83%), Query Frame = -2
Query:   20 TERYSNLYFNRPDVQKALHANVTGIPYTWKTCSDIVGNFWTDSPLSMLPIYHELINASLRIWVFSGDTDAVVPLTATRYSIDALKLPTVVNWYPWYNSGKVGGWSQVYKGLTFVTVPAXG 379
            TERY+ +Y+NRPDVQKALHAN T IPY W  CS+++   W D+  ++LPIY E+I   +R+WVFSGD D+VVP+TATRYS+  L L T + WYPWY   +VGGW++VY+GLTFVTV   G
Sbjct:  327 TERYAEIYYNRPDVQKALHANTTKIPYKWTACSEVLNRNWNDTDSTVLPIYREMIAGGIRVWVFSGDVDSVVPVTATRYSLARLSLSTKLPWYPWYVKKQVGGWTEVYEGLTFVTVRGAG 446          
BLAST of GH720521 vs. TAIR peptide
Match: AT2G24000.2 (| Symbols: scpl22 | serine carboxypeptidase-like 22 | chr2:10209475-10214042 FORWARD LENGTH=401)

HSP 1 Score: 159.458 bits (402), Expect = 5.393e-40
Identity = 74/122 (60.66%), Postives = 90/122 (73.77%), Query Frame = -2
Query:   20 TERYSNLYFNRPDVQKALHANVTGIPYTWKTCSDIVGNFWT--DSPLSMLPIYHELINASLRIWVFSGDTDAVVPLTATRYSIDALKLPTVVNWYPWYNSGKVGGWSQVYKGLTFVTVPAXG 379
            TE Y+ +Y+NRP+VQ+A+HAN T IPY W  CSD V N W   DS  SMLPIY ELI A LRIWV+SGDTD+V+P+TATRYS+  L L     WYPWY+  +VGG ++VY+GLTFVTV   G
Sbjct:  252 TENYAEIYYNRPEVQRAMHANHTAIPYKWTACSDSVFNNWNWRDSDNSMLPIYKELIAAGLRIWVYSGDTDSVIPVTATRYSLGKLNLRVKTRWYPWYSGNQVGGRTEVYEGLTFVTVRGAG 373          
BLAST of GH720521 vs. TAIR peptide
Match: AT2G24000.1 (| Symbols: scpl22 | serine carboxypeptidase-like 22 | chr2:10209475-10214042 FORWARD LENGTH=464)

HSP 1 Score: 159.458 bits (402), Expect = 5.393e-40
Identity = 74/122 (60.66%), Postives = 90/122 (73.77%), Query Frame = -2
Query:   20 TERYSNLYFNRPDVQKALHANVTGIPYTWKTCSDIVGNFWT--DSPLSMLPIYHELINASLRIWVFSGDTDAVVPLTATRYSIDALKLPTVVNWYPWYNSGKVGGWSQVYKGLTFVTVPAXG 379
            TE Y+ +Y+NRP+VQ+A+HAN T IPY W  CSD V N W   DS  SMLPIY ELI A LRIWV+SGDTD+V+P+TATRYS+  L L     WYPWY+  +VGG ++VY+GLTFVTV   G
Sbjct:  315 TENYAEIYYNRPEVQRAMHANHTAIPYKWTACSDSVFNNWNWRDSDNSMLPIYKELIAAGLRIWVYSGDTDSVIPVTATRYSLGKLNLRVKTRWYPWYSGNQVGGRTEVYEGLTFVTVRGAG 436          
BLAST of GH720521 vs. TAIR peptide
Match: AT4G30810.1 (| Symbols: scpl29 | serine carboxypeptidase-like 29 | chr4:15003474-15006017 FORWARD LENGTH=479)

HSP 1 Score: 155.221 bits (391), Expect = 1.017e-38
Identity = 74/120 (61.67%), Postives = 86/120 (71.67%), Query Frame = -2
Query:   20 TERYSNLYFNRPDVQKALHANVTGIPYTWKTCSDIVGNFWTDSPLSMLPIYHELINASLRIWVFSGDTDAVVPLTATRYSIDALKLPTVVNWYPWYNSGKVGGWSQVYKGLTFVTVPAXG 379
            TE+++ +YFN P+VQKALH      P  W TCSD+V   W DSP S+L IYHELI A LRIWVFSGD DAVVP+T+TRYSIDAL L  +  + PWY  G+VGGWSQ Y GL FVTV   G
Sbjct:  318 TEKHTTVYFNLPEVQKALHVPPGLAPSKWDTCSDVVSEHWNDSPSSVLNIYHELIAAGLRIWVFSGDADAVVPVTSTRYSIDALNLRPLSAYGPWYLDGQVGGWSQQYAGLNFVTVRGAG 437          
BLAST of GH720521 vs. TAIR peptide
Match: AT5G23210.2 (| Symbols: SCPL34 | serine carboxypeptidase-like 34 | chr5:7811625-7814837 FORWARD LENGTH=403)

HSP 1 Score: 142.895 bits (359), Expect = 5.223e-35
Identity = 67/117 (57.26%), Postives = 81/117 (69.23%), Query Frame = -2
Query:   20 YSNLYFNRPDVQKALHANVTGIPYTWKTCSDIVGNFWTDSPLSMLPIYHELINASLRIWVFSGDTDAVVPLTATRYSIDALKLPTVVNWYPWYNSGKVGGWSQVYKGLTFVTVPAXG 370
            Y+  Y NR DVQ+ALHANVT I Y W  CSD V +FW+D+P SMLP    L++A LR+WVFSGDTD  +P+TATRYS+  L L  V +W PWY   +VGGW+  Y GL FVTV   G
Sbjct:  259 YTEKYMNRKDVQEALHANVTNISYPWTHCSDTV-SFWSDAPASMLPTLRTLVSAGLRVWVFSGDTDGRIPVTATRYSLKKLGLKIVQDWTPWYTKLQVGGWTVEYDGLMFVTVRGAG 374          
BLAST of GH720521 vs. TAIR peptide
Match: AT5G23210.1 (| Symbols: SCPL34 | serine carboxypeptidase-like 34 | chr5:7810892-7814837 FORWARD LENGTH=499)

HSP 1 Score: 142.895 bits (359), Expect = 5.223e-35
Identity = 67/117 (57.26%), Postives = 81/117 (69.23%), Query Frame = -2
Query:   20 YSNLYFNRPDVQKALHANVTGIPYTWKTCSDIVGNFWTDSPLSMLPIYHELINASLRIWVFSGDTDAVVPLTATRYSIDALKLPTVVNWYPWYNSGKVGGWSQVYKGLTFVTVPAXG 370
            Y+  Y NR DVQ+ALHANVT I Y W  CSD V +FW+D+P SMLP    L++A LR+WVFSGDTD  +P+TATRYS+  L L  V +W PWY   +VGGW+  Y GL FVTV   G
Sbjct:  355 YTEKYMNRKDVQEALHANVTNISYPWTHCSDTV-SFWSDAPASMLPTLRTLVSAGLRVWVFSGDTDGRIPVTATRYSLKKLGLKIVQDWTPWYTKLQVGGWTVEYDGLMFVTVRGAG 470          
The following BLAST results are available for this feature:
BLAST of GH720521 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
B9HLN0_POPTR2.173e-5682.50Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
B9HU47_POPTR4.840e-5682.50Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
D7L738_ARALY1.009e-5379.17Putative uncharacterized protein OS=Arabidopsis ly... [more]
Q5QLC0_ORYSJ2.248e-5378.33Os01g0833500 protein OS=Oryza sativa subsp. japoni... [more]
A2WWP2_ORYSI2.248e-5378.33Putative uncharacterized protein OS=Oryza sativa s... [more]
C5XP10_SORBI3.247e-5275.83Putative uncharacterized protein Sb03g038940 OS=So... [more]
C4IZC7_MAIZE3.247e-5275.83Putative uncharacterized protein OS=Zea mays PE=2 ... [more]
B6U5U4_MAIZE3.247e-5275.83Virulence-related protein Nf314 OS=Zea mays PE=2 S... [more]
D7TMB8_VITVI7.997e-5177.50Whole genome shotgun sequence of line PN40024, sca... [more]
A5BPW0_VITVI7.997e-5177.50Putative uncharacterized protein OS=Vitis vinifera... [more]
back to top
BLAST of GH720521 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Swissprot)
Total hits: 10
Match NameE-valueIdentityDescription
SCP27_ARATH5.481e-5479.17Serine carboxypeptidase-like 27 OS=Arabidopsis tha... [more]
SCP26_ARATH1.001e-4770.83Serine carboxypeptidase-like 26 OS=Arabidopsis tha... [more]
CBP21_HORVU3.805e-4767.46Serine carboxypeptidase II-1 (Fragment) OS=Hordeum... [more]
CBP2_WHEAT5.494e-4671.90Serine carboxypeptidase 2 OS=Triticum aestivum GN=... [more]
CBP2_HORVU4.353e-4369.67Serine carboxypeptidase 2 OS=Hordeum vulgare GN=CB... [more]
SCP24_ARATH6.286e-4261.67Serine carboxypeptidase 24 OS=Arabidopsis thaliana... [more]
SCP23_ARATH3.120e-4160.00Putative serine carboxypeptidase-like 23 OS=Arabid... [more]
SCP25_ARATH5.321e-4159.17Serine carboxypeptidase-like 25 OS=Arabidopsis tha... [more]
SCP22_ARATH4.980e-3960.66Serine carboxypeptidase-like 22 OS=Arabidopsis tha... [more]
SCP29_ARATH9.393e-3861.67Serine carboxypeptidase-like 29 OS=Arabidopsis tha... [more]
back to top
BLAST of GH720521 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide)
Total hits: 10
Match NameE-valueIdentityDescription
AT3G07990.15.935e-5579.17| Symbols: SCPL27 | serine carboxypeptidase-like 2... [more]
AT2G35780.11.084e-4870.83| Symbols: scpl26 | serine carboxypeptidase-like 2... [more]
AT4G30610.16.806e-4361.67| Symbols: BRS1, SCPL24 | alpha/beta-Hydrolases su... [more]
AT2G24010.13.378e-4260.00| Symbols: scpl23 | serine carboxypeptidase-like 2... [more]
AT3G02110.15.762e-4259.17| Symbols: scpl25 | serine carboxypeptidase-like 2... [more]
AT2G24000.25.393e-4060.66| Symbols: scpl22 | serine carboxypeptidase-like 2... [more]
AT2G24000.15.393e-4060.66| Symbols: scpl22 | serine carboxypeptidase-like 2... [more]
AT4G30810.11.017e-3861.67| Symbols: scpl29 | serine carboxypeptidase-like 2... [more]
AT5G23210.25.223e-3557.26| Symbols: SCPL34 | serine carboxypeptidase-like 3... [more]
AT5G23210.15.223e-3557.26| Symbols: SCPL34 | serine carboxypeptidase-like 3... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001563Peptidase S10, serine carboxypeptidasePANTHERPTHR11802SERINE PROTEASE FAMILY S10 SERINE CARBOXYPEPTIDASEcoord: 7..122
score: 3
IPR001563Peptidase S10, serine carboxypeptidasePFAMPF00450Peptidase_S10coord: 8..125
score: 9.3
NoneNo IPR availableGENE3D3.40.50.1820no descriptioncoord: 7..122
score: 3.3
NoneNo IPR availablePANTHERPTHR11802:SF8SERINE CARBOXYPEPTIDASE II (CARBOXYPEPTIDASE D) (PLANTS)coord: 7..122
score: 3
NoneNo IPR availableSUPERFAMILY53474alpha/beta-Hydrolasescoord: 10..126
score: 6.4

Properties
Property NameValue
Singlet in analysisPisum sativum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>GH720521 ID=GH720521|Name=GH720521|organism=Pisum sativum|type=EST|length=398bp
TTTTCTATTTCGAGCGGCCGCCCNGGGCAGGTACTGTCACGAACGTGAGC
CCTTTATAAACTTGGCTCCATCCACCAACCTTGCCACTGTTATACCAAGG
ATACCAATTTACGACGGTTGGAAGCTTCAACGCGTCTATAGAATATCGAG
TGGCGGTTAGTGGAACTACAGCATCAGTGTCTCCACTGAATACCCATATT
CGTAGACTAGCATTGATAAGTTCGTGATATATCGGAAGCATAGACAAAGG
CGAATCGGTCCAAAAATTCCCAACAATATCACTGCATGTTTTCCATGTAT
ATGGAATCCCTGTTACATTAGCATGAAGTGCCTTCTGAACATCTGGACGG
TTGAAATACAAATTGGAATACCTTTCGGTACCTCGGCCGCGACCACGC
back to top
Annotated Terms
The following terms have been associated with this EST:
Vocabulary: Molecular Function
TermDefinition
GO:0004185serine-type carboxypeptidase activity
Vocabulary: Biological Process
TermDefinition
GO:0006508proteolysis
Vocabulary: INTERPRO
TermDefinition
IPR001563Peptidase_S10