CD858816

EST Overview
NameCD858816
Unique NameCD858816
TypeEST
OrganismPisum sativum (pea)
Sequence length502
Libraries
Library NameType
LIBEST_013997 CIcdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Pisum sativum unigene v2Pisum sativum unigene v2EST
Pisum sativum unigene v1Pisum sativum unigene v1EST
Homology
BLAST of CD858816 vs. TrEMBL
Match: C6T1I7_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 4.231e-54
Identity = 99/131 (75.57%), Postives = 110/131 (83.97%), Query Frame = 1
Query:   37 SFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQRK-DCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            S  +LCVLGL+ IVG HVAYAQDSP DYVNAHNAARSQVGV NIVWDN VAAFAQNYANQRK DC+L+HSGG G+YGEN+A STG +SG DAV+LWVNEKS Y+YNSN+C  G+ C HYT VV  NS RLG
Sbjct:    7 SLCLLCVLGLV-IVGDHVAYAQDSPTDYVNAHNAARSQVGVPNIVWDNAVAAFAQNYANQRKGDCKLVHSGGDGKYGENLAGSTGNLSGKDAVQLWVNEKSKYNYNSNSCVGGE-CLHYTQVVWRNSLRLG 135          

HSP 2 Score: 36.5798 bits (83), Expect = 4.231e-54
Identity = 13/19 (68.42%), Postives = 15/19 (78.95%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            C+NGGT I CNY PPG Y+
Sbjct:  141 CNNGGTSIGCNYAPPGNYI 159          
BLAST of CD858816 vs. TrEMBL
Match: C6T1N0_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 1.089e-48
Identity = 92/140 (65.71%), Postives = 110/140 (78.57%), Query Frame = 1
Query:   37 SFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVG---------VSNIVWDNTVAAFAQNYANQRK-DCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            SF ++CVLGL+ IVG  VAYAQDS  DYVNAHNAAR++VG         V ++ WD+TVAA+A++YANQRK DCQLIHSGG   YGENIAMSTG +SGTDAVK+WV+EKS+YDY+SN+C  G+ C HYT VV  NS RLG
Sbjct:    9 SFCVMCVLGLV-IVGD-VAYAQDSAEDYVNAHNAARAEVGSQSPRQTVIVPSLAWDDTVAAYAESYANQRKGDCQLIHSGG--EYGENIAMSTGELSGTDAVKMWVDEKSNYDYDSNSCVGGE-CLHYTQVVWANSVRLG 143          

HSP 2 Score: 46.2098 bits (108), Expect = 1.089e-48
Identity = 17/19 (89.47%), Postives = 18/19 (94.74%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            CDNGGTFITCNYDPPG +V
Sbjct:  149 CDNGGTFITCNYDPPGNFV 167          
BLAST of CD858816 vs. TrEMBL
Match: Q9XFB4_SOYBN (PR1a OS=Glycine max GN=PR1a PE=2 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 4.449e-47
Identity = 90/140 (64.29%), Postives = 108/140 (77.14%), Query Frame = 1
Query:   37 SFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVG---------VSNIVWDNTVAAFAQNYANQRK-DCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            SF ++CVLGL+ IVG  VAYAQDS  DYVNAHNAA ++VG         V ++ WD+TVAA+A++YANQRK DCQLIHSGG   YGENIAMSTG +SGTDAVK+WV+EKS+ DY+SN+C  G+ C HYT VV  NS RLG
Sbjct:    9 SFCVMCVLGLV-IVGD-VAYAQDSAEDYVNAHNAAEAEVGSQSPRQTVIVPSLAWDDTVAAYAESYANQRKGDCQLIHSGG--EYGENIAMSTGELSGTDAVKMWVDEKSNCDYDSNSCVGGE-CLHYTQVVWANSVRLG 143          

HSP 2 Score: 46.2098 bits (108), Expect = 4.449e-47
Identity = 17/19 (89.47%), Postives = 18/19 (94.74%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            CDNGGTFITCNYDPPG +V
Sbjct:  149 CDNGGTFITCNYDPPGNFV 167          
BLAST of CD858816 vs. TrEMBL
Match: B9S7U9_RICCO (STS14 protein, putative OS=Ricinus communis GN=RCOM_1381930 PE=4 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 2.849e-46
Identity = 84/131 (64.12%), Postives = 102/131 (77.86%), Query Frame = 1
Query:   37 SFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQR-KDCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            S ++  ++ L  I+ SH   AQ+ P DY+NAHNAAR+ VGV  + WDNTVAA+AQNYANQR  DC+L+HSGG  RYGENIA S+G +SGT AVKLWV+EK+ Y+YNSNTCAAG+ CGHYT VV  NS RLG
Sbjct:    7 SAALSFLISLSLILSSH---AQNLPQDYINAHNAARAAVGVGPMTWDNTVAAYAQNYANQRINDCRLVHSGG--RYGENIAWSSGDLSGTAAVKLWVDEKAFYNYNSNTCAAGQQCGHYTQVVWRNSVRLG 132          

HSP 2 Score: 43.1282 bits (100), Expect = 2.849e-46
Identity = 16/19 (84.21%), Postives = 17/19 (89.47%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            C NGGTFITCNYDPPG +V
Sbjct:  138 CRNGGTFITCNYDPPGNFV 156          
BLAST of CD858816 vs. TrEMBL
Match: B5QTD3_BETVU (Pathogenesis-related protein 1a OS=Beta vulgaris GN=pr1a PE=2 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 1.972e-44
Identity = 78/119 (65.55%), Postives = 94/119 (78.99%), Query Frame = 1
Query:   82 SHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQRK-DCQLIHSGGGGRYGENIAMSTGG---MSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            + + +AQ+SP DYVNAHN AR+ VGV NI WD+ VAAFAQ YA+QRK DC L HSGGGGRYGEN+A  +G    ++ T AV++WV EK+DYDYNSNTCA+GKVCGHYT VV  +S RLG
Sbjct:   21 AQMCHAQNSPQDYVNAHNDARAAVGVGNIQWDDQVAAFAQQYADQRKGDCVLQHSGGGGRYGENLAGGSGPGLVLTATTAVQMWVAEKADYDYNSNTCASGKVCGHYTQVVWRDSVRLG 139          

HSP 2 Score: 43.5134 bits (101), Expect = 1.972e-44
Identity = 15/19 (78.95%), Postives = 17/19 (89.47%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            CDNGG F+TCNYDPPG +V
Sbjct:  145 CDNGGIFVTCNYDPPGNFV 163          
BLAST of CD858816 vs. TrEMBL
Match: Q00MX6_MALDO (Pathogenesis-related protein 1a OS=Malus domestica PE=2 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 3.636e-43
Identity = 79/131 (60.31%), Postives = 96/131 (73.28%), Query Frame = 1
Query:   37 SFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQRK-DCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            S ++L +LG + I  SH   AQD+P DY+ +HN AR+ VGV  + WD+ VA +AQNYANQ   DC L+HSGG   YGEN+AMSTG MSGT AV +WV EK+DY Y SN+CA GKVCGHYT VV  NSAR+G
Sbjct:    7 SLALLFILGSVLIQSSH---AQDTPQDYLKSHNDARAAVGVGPLTWDDKVAGYAQNYANQHVGDCNLVHSGGP--YGENLAMSTGDMSGTAAVDMWVAEKADYSYESNSCADGKVCGHYTQVVWRNSARVG 132          

HSP 2 Score: 40.817 bits (94), Expect = 3.636e-43
Identity = 15/19 (78.95%), Postives = 16/19 (84.21%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            C +GGTFI CNYDPPG YV
Sbjct:  138 CSSGGTFIGCNYDPPGNYV 156          
BLAST of CD858816 vs. TrEMBL
Match: A5BC26_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_042545 PE=4 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 4.739e-43
Identity = 78/133 (58.65%), Postives = 99/133 (74.44%), Query Frame = 1
Query:   31 MSSFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQR-KDCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            +   S+  ++GL+ +  +H   AQ+SP DYV+AHNAAR+QVGV +I W++TVAA+AQNYANQR  DC L+HS  GG YGEN+A  +G ++GTDAV LWV EK  YDYNSN+C  G+ CGHYT VV  NS RLG
Sbjct:    3 LCKISMALLVGLMGLALAHTCCAQNSPQDYVDAHNAARAQVGVGSITWNDTVAAYAQNYANQRISDCNLVHS--GGPYGENLAKGSGSLTGTDAVNLWVGEKPYYDYNSNSCVGGE-CGHYTQVVWRNSVRLG 132          

HSP 2 Score: 39.6614 bits (91), Expect = 4.739e-43
Identity = 14/19 (73.68%), Postives = 16/19 (84.21%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            C+NG  F+TCNYDPPG YV
Sbjct:  138 CNNGWWFVTCNYDPPGNYV 156          
BLAST of CD858816 vs. TrEMBL
Match: A9PEI1_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_581980 PE=2 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 4.739e-43
Identity = 82/133 (61.65%), Postives = 98/133 (73.68%), Query Frame = 1
Query:   31 MSSFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQRK-DCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            MSS   L    LI +     + AQD+P DY++AHNAAR+ VGV  + WD TV A+AQNYANQR  DC L+HSGG   YGENIA S+  +SGTDAVK+WV+EK+ YDYNSN+CAAG+ CGHYT VV  NSARLG
Sbjct:    2 MSSKISLAFFTLITLSLILPSRAQDNPQDYLDAHNAARAAVGVGPLTWDTTVQAYAQNYANQRAGDCNLVHSGGP--YGENIAWSSADLSGTDAVKMWVDEKAYYDYNSNSCAAGQQCGHYTQVVWRNSARLG 132          

HSP 2 Score: 40.4318 bits (93), Expect = 4.739e-43
Identity = 15/19 (78.95%), Postives = 15/19 (78.95%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            C  GGTFI CNYDPPG YV
Sbjct:  138 CSTGGTFIGCNYDPPGNYV 156          
BLAST of CD858816 vs. TrEMBL
Match: B9HN42_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_649729 PE=4 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 6.176e-43
Identity = 82/133 (61.65%), Postives = 98/133 (73.68%), Query Frame = 1
Query:   31 MSSFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQRK-DCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            MSS   L    LI +     + AQD+P DY++AHNAAR+ VGV  + WD TV A+AQNYANQR  DC LIHSGG   YGEN+A S+  +SGTDAVK+WV+EK+ YDYNSN+CAAG+ CGHYT VV  NSARLG
Sbjct:    2 MSSNISLAFFTLITLSLILPSRAQDNPQDYLDAHNAARAAVGVGPLTWDTTVQAYAQNYANQRAGDCNLIHSGGP--YGENLAWSSADLSGTDAVKMWVDEKAYYDYNSNSCAAGQQCGHYTQVVWRNSARLG 132          

HSP 2 Score: 40.4318 bits (93), Expect = 6.176e-43
Identity = 15/19 (78.95%), Postives = 15/19 (78.95%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            C  GGTFI CNYDPPG YV
Sbjct:  138 CSTGGTFIGCNYDPPGNYV 156          
BLAST of CD858816 vs. TrEMBL
Match: A5BNW5_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_021166 PE=4 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 6.177e-43
Identity = 79/132 (59.85%), Postives = 98/132 (74.24%), Query Frame = 1
Query:   34 SSFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQR-KDCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            S  ++LC +GL     +H+  AQ+SP DY+NAHN AR+QVGV  + WDNTVAA+AQNYANQR  DC L+HS  GG YGEN+A  +  ++GTDAV LWV EKS+YDYNSN+C  G+ CGHYT VV + S RLG
Sbjct:    6 SPLALLCFMGLAL---AHICCAQNSPQDYLNAHNTARAQVGVGPMSWDNTVAAYAQNYANQRIGDCNLVHS--GGPYGENLAWGSPSLTGTDAVNLWVGEKSNYDYNSNSCVGGQ-CGHYTQVVWSKSVRLG 131          

HSP 2 Score: 38.891 bits (89), Expect = 6.177e-43
Identity = 13/19 (68.42%), Postives = 16/19 (84.21%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            C+NGG F+TCNYDP G Y+
Sbjct:  137 CNNGGWFVTCNYDPRGNYI 155          
BLAST of CD858816 vs. SwissProt
Match: PR1C_TOBAC (Pathogenesis-related protein 1C OS=Nicotiana tabacum PE=2 SV=3)

HSP 1 Score: 142.895 bits (359), Expect = 4.662e-38
Identity = 71/141 (50.35%), Postives = 102/141 (72.34%), Query Frame = 1
Query:   10 KLIVITKMSSFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQ-RKDCQLIHSGGGGRYGENIAMSTGG-MSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            + ++ ++MSSF ++  L L+F++ SH  +AQ+S  DY++AHN AR+ VGV  + WD+ VAA+AQNYA+Q   DC L+HS   G+YGEN+A  +G  ++   AV++WVNEK  Y ++SNTCA G+VCGHYT VV  NS R+G
Sbjct:    2 EFVLFSQMSSFFLVSTL-LLFLIISHSCHAQNSQQDYLDAHNTARADVGVEPLTWDDQVAAYAQNYASQLAADCNLVHS--HGQYGENLAWGSGDFLTAAKAVEMWVNEKQYYAHDSNTCAQGQVCGHYTQVVWRNSVRVG 139          

HSP 2 Score: 35.4242 bits (80), Expect = 4.662e-38
Identity = 11/19 (57.89%), Postives = 15/19 (78.95%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            C+NGG  ++CNYDPPG  +
Sbjct:  145 CNNGGYIVSCNYDPPGNVI 163          
BLAST of CD858816 vs. SwissProt
Match: PR1B_TOBAC (Pathogenesis-related protein 1B OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 7.913e-38
Identity = 71/138 (51.45%), Postives = 100/138 (72.46%), Query Frame = 1
Query:   19 VITKMSSFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQ-RKDCQLIHSGGGGRYGENIAMSTGG-MSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            + ++M SF ++  L L+F++ SH ++AQ+S  DY++AHN AR+ VGV  + WDN VAA+AQNY +Q   DC L+HS   G+YGEN+A  +G  M+   AV++WV+EK  YD++SNTCA G+VCGHYT VV  NS R+G
Sbjct:    5 LFSQMPSFFLVSTL-LLFLIISHSSHAQNSQQDYLDAHNTARADVGVEPLTWDNGVAAYAQNYVSQLAADCNLVHS--HGQYGENLAQGSGDFMTAAKAVEMWVDEKQYYDHDSNTCAQGQVCGHYTQVVWRNSVRVG 139          

HSP 2 Score: 35.039 bits (79), Expect = 7.913e-38
Identity = 11/19 (57.89%), Postives = 15/19 (78.95%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            C+NGG  ++CNYDPPG  +
Sbjct:  145 CNNGGYVVSCNYDPPGNVI 163          
BLAST of CD858816 vs. SwissProt
Match: PR1A_TOBAC (Pathogenesis-related protein 1A OS=Nicotiana tabacum PE=1 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 1.031e-37
Identity = 71/139 (51.08%), Postives = 100/139 (71.94%), Query Frame = 1
Query:   16 IVITKMSSFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQ-RKDCQLIHSGGGGRYGENIAMSTGG-MSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            ++ +++ SF ++  L L+F+V SH   AQ+S  DY++AHN AR+ VGV  + WD+ VAA+AQNYA+Q   DC L+HS   G+YGEN+A  +G  M+   AV++WV+EK  YD++SNTCA G+VCGHYT VV  NS R+G
Sbjct:    4 VLFSQLPSFLLVSTL-LLFLVISHSCRAQNSQQDYLDAHNTARADVGVEPLTWDDQVAAYAQNYASQLAADCNLVHS--HGQYGENLAEGSGDFMTAAKAVEMWVDEKQYYDHDSNTCAQGQVCGHYTQVVWRNSVRVG 139          

HSP 2 Score: 36.965 bits (84), Expect = 1.031e-37
Identity = 12/18 (66.67%), Postives = 15/18 (83.33%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTY 497
            C+NGG  ++CNYDPPG Y
Sbjct:  145 CNNGGYVVSCNYDPPGNY 162          
BLAST of CD858816 vs. SwissProt
Match: PR1_SAMNI (Pathogenesis-related protein PR-1 type OS=Sambucus nigra PE=2 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 1.031e-37
Identity = 70/132 (53.03%), Postives = 95/132 (71.97%), Query Frame = 1
Query:   37 SFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQRK-DCQLIHSGGGGRYGENIAMSTG-GMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            S +++CV+ L+ +     + AQ+SP DYV+AHNAARS V V  + WD +VAAFA+ YA  R  DC+L+HS G  RYGEN+A  +G  ++G +AV +WV E++DY+ N+NTCA GKVCGHYT VV  NS R+G
Sbjct:   11 SVALVCVVALVMV---QYSVAQNSPQDYVDAHNAARSAVNVGPVTWDESVAAFARQYAQSRAGDCRLVHS-GDPRYGENLAFGSGFELTGRNAVDMWVAERNDYNPNTNTCAPGKVCGHYTQVVWRNSVRIG 138          

HSP 2 Score: 36.965 bits (84), Expect = 1.031e-37
Identity = 13/18 (72.22%), Postives = 14/18 (77.78%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTY 497
            C+NG  FITCNY PPG Y
Sbjct:  144 CNNGAWFITCNYSPPGNY 161          
BLAST of CD858816 vs. SwissProt
Match: PRB1_TOBAC (Basic form of pathogenesis-related protein 1 OS=Nicotiana tabacum PE=3 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 4.173e-36
Identity = 70/122 (57.38%), Postives = 86/122 (70.49%), Query Frame = 1
Query:   64 LIFIVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQR-KDCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            + F +  H + AQ+SP DY+N HNAAR QVGV  + WDN +AA+AQNYANQR  DC +IHS   G YGEN+A +   ++   AVK+WV+EK  YDYNSN+C  G VCGHYT VV  NS RLG
Sbjct:   12 ITFAILIHSSKAQNSPQDYLNPHNAARRQVGVGPMTWDNRLAAYAQNYANQRIGDCGMIHS--HGPYGENLAAAFPQLNAAGAVKMWVDEKRFYDYNSNSCVGG-VCGHYTQVVWRNSVRLG 130          

HSP 2 Score: 34.6538 bits (78), Expect = 4.173e-36
Identity = 12/18 (66.67%), Postives = 15/18 (83.33%), Query Frame = 3
Query:  447 DNGGTFITCNYDPPGTYV 500
            +NG  FITCNYDPPG ++
Sbjct:  137 NNGWFFITCNYDPPGNFI 154          
BLAST of CD858816 vs. SwissProt
Match: PR1A_SOLLC (Pathogenesis-related protein 1A1 OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 9.226e-36
Identity = 69/132 (52.27%), Postives = 87/132 (65.91%), Query Frame = 1
Query:   34 SSFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQRKD-CQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            SS  + C +  I     H + AQ    +++NAHNAAR +VGV  + WD+ +AA+AQNYANQR D C +IHS G   YGEN+A +   ++   AVK+W +EK  YDYNSNTCA GKVCGHYT VV   S RLG
Sbjct:    3 SSIFVACFITFIIF---HSSQAQTPRENFLNAHNAARRRVGVGPMTWDDGLAAYAQNYANQRADDCGMIHSDGP--YGENLAAAFPQLNAAGAVKMWDDEKQWYDYNSNTCAPGKVCGHYTQVVWRKSVRLG 129          

HSP 2 Score: 38.5058 bits (88), Expect = 9.226e-36
Identity = 13/19 (68.42%), Postives = 16/19 (84.21%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            C++G  FITCNYDPPG Y+
Sbjct:  135 CNSGWVFITCNYDPPGNYI 153          
BLAST of CD858816 vs. SwissProt
Match: PR1_HORVU (Pathogenesis-related protein 1 OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 1.826e-33
Identity = 69/117 (58.97%), Postives = 81/117 (69.23%), Query Frame = 1
Query:   85 HVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQR-KDCQLIHSGGGGRYGENIAMSTGGMS--GTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            +++ AQ+SP DYV+ HNAARS VGV  + W   + AFAQNYANQR  DC+L HSGG   YGENI   + G     +DAV  WV+EK DYDY SNTCAAGKVCGHYT VV   S  +G
Sbjct:   20 NLSQAQNSPQDYVSPHNAARSAVGVGAVSWSTKLQAFAQNYANQRINDCKLQHSGGP--YGENIFWGSAGADWKASDAVNSWVSEKKDYDYGSNTCAAGKVCGHYTQVVWRASTSIG 134          

HSP 2 Score: 28.8758 bits (63), Expect = 1.826e-33
Identity = 10/18 (55.56%), Postives = 13/18 (72.22%), Query Frame = 3
Query:  447 DNGGTFITCNYDPPGTYV 500
            +N G FITCNY+P G  +
Sbjct:  142 NNRGVFITCNYEPRGNII 159          
BLAST of CD858816 vs. SwissProt
Match: PR12_HORVU (Pathogenesis-related protein PRB1-2 OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 1.826e-33
Identity = 69/117 (58.97%), Postives = 80/117 (68.38%), Query Frame = 1
Query:   85 HVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQR-KDCQLIHSGGGGRYGENIAMSTGGMS--GTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            +++ AQ+SP DYV+ HNAARS VGV  + W   + AFAQNYANQR  DC+L HSGG   YGENI   + G      DAV  WVNEK DY+Y SNTCAAGKVCGHYT VV   S  +G
Sbjct:   20 NLSQAQNSPQDYVSPHNAARSAVGVGAVSWSTKLQAFAQNYANQRINDCKLQHSGGP--YGENIFWGSAGADWKAADAVNSWVNEKKDYNYGSNTCAAGKVCGHYTQVVWRASTSIG 134          

HSP 2 Score: 29.261 bits (64), Expect = 1.826e-33
Identity = 11/18 (61.11%), Postives = 13/18 (72.22%), Query Frame = 3
Query:  447 DNGGTFITCNYDPPGTYV 500
            +N G FITCNY+P G  V
Sbjct:  142 NNRGVFITCNYEPRGNIV 159          
BLAST of CD858816 vs. SwissProt
Match: PR1_ARATH (Pathogenesis-related protein 1 OS=Arabidopsis thaliana GN=At2g14610 PE=1 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 2.380e-33
Identity = 65/123 (52.85%), Postives = 85/123 (69.11%), Query Frame = 1
Query:   67 IFIVGSHV--AYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQ-RKDCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            + +VG+ V  + AQDSP DY+  HN AR  VGV  + WD  VAA+A++YA Q R +C+LIHSGG   YGEN+A  +G +SG  AV +WV+EK++Y+Y +NTC    VCGHYT VV   S RLG
Sbjct:   14 VALVGALVLPSKAQDSPQDYLRVHNQARGAVGVGPMQWDERVAAYARSYAEQLRGNCRLIHSGGP--YGENLAWGSGDLSGVSAVNMWVSEKANYNYAANTC--NGVCGHYTQVVWRKSVRLG 132          

HSP 2 Score: 38.5058 bits (88), Expect = 2.380e-33
Identity = 14/19 (73.68%), Postives = 16/19 (84.21%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            C+NGGT I+CNYDP G YV
Sbjct:  138 CNNGGTIISCNYDPRGNYV 156          
BLAST of CD858816 vs. SwissProt
Match: PR13_HORVU (Pathogenesis-related protein PRB1-3 OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 3.097e-33
Identity = 68/117 (58.12%), Postives = 81/117 (69.23%), Query Frame = 1
Query:   85 HVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQR-KDCQLIHSGGGGRYGENIAMSTGGMS--GTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            +++ AQ+SP DYV+ HNAAR+ VGV  + W   + AFAQNYANQR  DC+L HSGG   YGENI   + G     +DAV  WV+EK DYDY SNTCAAGKVCGHYT VV   S  +G
Sbjct:   20 NLSQAQNSPQDYVSPHNAARAAVGVGAVSWSTKLQAFAQNYANQRINDCKLQHSGGP--YGENIFWGSAGADWKASDAVNSWVSEKKDYDYGSNTCAAGKVCGHYTQVVWRASTSIG 134          

HSP 2 Score: 29.261 bits (64), Expect = 3.097e-33
Identity = 11/18 (61.11%), Postives = 13/18 (72.22%), Query Frame = 3
Query:  447 DNGGTFITCNYDPPGTYV 500
            +N G FITCNY+P G  V
Sbjct:  142 NNRGVFITCNYEPRGNIV 159          
BLAST of CD858816 vs. TAIR peptide
Match: AT2G14580.1 (| Symbols: ATPRB1, PRB1 | basic pathogenesis-related protein 1 | chr2:6225703-6226188 REVERSE LENGTH=161)

HSP 1 Score: 139.428 bits (350), Expect = 1.781e-39
Identity = 76/136 (55.88%), Postives = 98/136 (72.06%), Query Frame = 1
Query:   28 KMSSFSILCVLGLIFIVGSHVA--YAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQRK-DCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            K++S+S + ++ L  +VG+ V    AQDS  DYVNAHN ARSQ+GV  + WD  +AA+A+NYANQ K DC+L+HS   G YGEN+A S G +SG  AV LWVNEK++Y+Y++NTC    VCGHYT VV  NS RLG
Sbjct:    2 KVTSYSRILII-LAALVGALVVPLKAQDSQQDYVNAHNQARSQIGVGPMQWDEGLAAYARNYANQLKGDCRLVHS--RGPYGENLAKSGGDLSGVAAVNLWVNEKANYNYDTNTC--NGVCGHYTQVVWRNSVRLG 132          

HSP 2 Score: 40.4318 bits (93), Expect = 1.781e-39
Identity = 14/18 (77.78%), Postives = 16/18 (88.89%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTY 497
            C+NGGT I+CNYDPPG Y
Sbjct:  138 CNNGGTIISCNYDPPGNY 155          
BLAST of CD858816 vs. TAIR peptide
Match: AT4G33720.1 (| Symbols: | CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein | chr4:16182813-16183304 FORWARD LENGTH=163)

HSP 1 Score: 138.658 bits (348), Expect = 2.319e-39
Identity = 71/132 (53.79%), Postives = 91/132 (68.94%), Query Frame = 1
Query:   34 SSFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQRK-DCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            SS ++   +    ++  H+  AQDSP D++  HN AR++VGV  + WD  VAA+A+NYANQRK DC + HS G   YGENIA S+G M+G  AV +WV+E+ DYDY+SNTCA  K CGHYT VV  NS RLG
Sbjct:    6 SSQNLFLAITFFLVLIVHLK-AQDSPQDFLAVHNRARAEVGVGPLRWDEKVAAYARNYANQRKGDCAMKHSSGS--YGENIAWSSGSMTGVAAVDMWVDEQFDYDYDSNTCAWDKQCGHYTQVVWRNSERLG 134          

HSP 2 Score: 40.817 bits (94), Expect = 2.319e-39
Identity = 15/19 (78.95%), Postives = 17/19 (89.47%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            C+NG TFITCNYDPPG +V
Sbjct:  140 CNNGQTFITCNYDPPGNWV 158          
BLAST of CD858816 vs. TAIR peptide
Match: AT5G26130.1 (| Symbols: | CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein | chr5:9128110-9128610 REVERSE LENGTH=166)

HSP 1 Score: 133.265 bits (334), Expect = 3.264e-38
Identity = 69/128 (53.91%), Postives = 84/128 (65.62%), Query Frame = 1
Query:   46 ILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQRK-DCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            IL V+ ++F+  +    AQD P DY++ HN AR+QVGV  + W      +A NYA QRK DC L HS   G YGEN+A S G +SG +AVKLWVNEKSDY Y SNTC+ GK CGHYT VV   S  +G
Sbjct:   11 ILSVI-VLFLAFAVPLKAQDQPQDYLDEHNRARTQVGVPPMKWHAGAEQYAWNYAQQRKGDCSLTHSNSNGLYGENLAWSGGALSGAEAVKLWVNEKSDYIYASNTCSDGKQCGHYTQVVWRTSEWVG 137          

HSP 2 Score: 42.3578 bits (98), Expect = 3.264e-38
Identity = 15/18 (83.33%), Postives = 16/18 (88.89%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTY 497
            CDNGGTF+TCNY PPG Y
Sbjct:  143 CDNGGTFVTCNYYPPGNY 160          
BLAST of CD858816 vs. TAIR peptide
Match: AT4G33710.1 (| Symbols: | CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein | chr4:16181065-16181565 FORWARD LENGTH=166)

HSP 1 Score: 130.954 bits (328), Expect = 4.958e-36
Identity = 69/128 (53.91%), Postives = 83/128 (64.84%), Query Frame = 1
Query:   49 LCVLGLIFIVGSHVAY-AQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQRK-DCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            L +L L  ++   V   AQD   DY++ HN AR  V V +I W    A +A NYA +RK DC+LIHS   GRYGEN+A S+G MSG  AV+LWV EKSDY + SNTC AGK CGHYT VV  NS  +G
Sbjct:   10 LVLLALALVLAFAVPLKAQDRRQDYLDVHNHARDDVSVPHIKWHAGAARYAWNYAQRRKRDCRLIHSNSRGRYGENLAWSSGDMSGAAAVRLWVREKSDYFHKSNTCRAGKQCGHYTQVVWKNSEWVG 137          

HSP 2 Score: 37.3502 bits (85), Expect = 4.958e-36
Identity = 13/16 (81.25%), Postives = 14/16 (87.50%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPG 491
            CDNGGTF+TCNY  PG
Sbjct:  143 CDNGGTFVTCNYSHPG 158          
BLAST of CD858816 vs. TAIR peptide
Match: AT3G19690.1 (| Symbols: | CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein | chr3:6842365-6842850 REVERSE LENGTH=161)

HSP 1 Score: 124.79 bits (312), Expect = 4.962e-36
Identity = 66/131 (50.38%), Postives = 87/131 (66.41%), Query Frame = 1
Query:   43 SILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQR-KDCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTC--AAGKVCGHYTHVVRTNSARLG 426
            +IL +L +    GS    A+D    ++ AHN AR++VG+  +VWD+ VAA+A +YANQR  DC L+HS G   +GENIAMS+G MS  DA ++W+NEK  YDY+SNTC    G  C HYT VV  N+ RLG
Sbjct:    7 NILFLLAIALFYGS---LAEDLQQQFLEAHNEARNEVGLDPLVWDDEVAAYAASYANQRINDCALVHSNGP--FGENIAMSSGEMSAEDAAEMWINEKQYYDYDSNTCNDPNGGTCLHYTQVVWKNTVRLG 132          

HSP 2 Score: 43.5134 bits (101), Expect = 4.962e-36
Identity = 15/19 (78.95%), Postives = 18/19 (94.74%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            C++GGTFITCNYDPPG Y+
Sbjct:  138 CNSGGTFITCNYDPPGNYI 156          
BLAST of CD858816 vs. TAIR peptide
Match: AT2G14610.1 (| Symbols: PR1, PR 1, ATPR1 | pathogenesis-related gene 1 | chr2:6241944-6242429 REVERSE LENGTH=161)

HSP 1 Score: 124.02 bits (310), Expect = 2.613e-34
Identity = 65/123 (52.85%), Postives = 85/123 (69.11%), Query Frame = 1
Query:   67 IFIVGSHV--AYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQ-RKDCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            + +VG+ V  + AQDSP DY+  HN AR  VGV  + WD  VAA+A++YA Q R +C+LIHSGG   YGEN+A  +G +SG  AV +WV+EK++Y+Y +NTC    VCGHYT VV   S RLG
Sbjct:   14 VALVGALVLPSKAQDSPQDYLRVHNQARGAVGVGPMQWDERVAAYARSYAEQLRGNCRLIHSGGP--YGENLAWGSGDLSGVSAVNMWVSEKANYNYAANTC--NGVCGHYTQVVWRKSVRLG 132          

HSP 2 Score: 38.5058 bits (88), Expect = 2.613e-34
Identity = 14/19 (73.68%), Postives = 16/19 (84.21%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            C+NGGT I+CNYDP G YV
Sbjct:  138 CNNGGTIISCNYDPRGNYV 156          
BLAST of CD858816 vs. TAIR peptide
Match: AT1G50060.1 (| Symbols: | CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein | chr1:18551186-18552446 FORWARD LENGTH=161)

HSP 1 Score: 125.176 bits (313), Expect = 2.508e-31
Identity = 65/128 (50.78%), Postives = 86/128 (67.19%), Query Frame = 1
Query:   49 LCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQRK-DCQLIHSGGGGRYGENIAM-STGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            L ++ + F+V +    AQ++P DY+N+HN AR+QVGV N+VWD T+AA+A NY+N RK DC L+HS   G YGEN+A  S+   S   AVKLWV+EK  Y Y  N C  GK C HYT VV  +S ++G
Sbjct:    9 LVIVAISFLVVA--TNAQNTPQDYLNSHNTARAQVGVPNVVWDTTLAAYALNYSNFRKADCNLVHS--NGPYGENLAKGSSSSFSAISAVKLWVDEKPYYSYAYNNCTGGKQCLHYTQVVWRDSVKIG 132          

HSP 2 Score: 27.335 bits (59), Expect = 2.508e-31
Identity = 9/19 (47.37%), Postives = 13/19 (68.42%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            C N   F++CNY+ PG +V
Sbjct:  138 CTNTWWFVSCNYNSPGNWV 156          
BLAST of CD858816 vs. TAIR peptide
Match: AT1G50050.1 (| Symbols: | CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein | chr1:18546165-18549046 FORWARD LENGTH=226)

HSP 1 Score: 121.709 bits (304), Expect = 1.579e-30
Identity = 63/128 (49.22%), Postives = 84/128 (65.62%), Query Frame = 1
Query:   49 LCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQRK-DCQLIHSGGGGRYGENIAMSTGGM-SGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            L ++ + F+V +    AQ++  DY+N HN AR+QVGV+N+VWD  VAA+A NYAN RK DC L  S GG  YGEN+A     + +G  AV LWVNEK  Y+Y +N C   + C HYT VV +NS ++G
Sbjct:    9 LIIVAISFLVLA--TNAQNAQQDYLNTHNTARAQVGVANVVWDTVVAAYATNYANARKVDCSLTPSTGGS-YGENLANGNNALFTGVAAVNLWVNEKPYYNYTANACIGAQQCKHYTQVVWSNSVKIG 133          

HSP 2 Score: 28.1054 bits (61), Expect = 1.579e-30
Identity = 9/13 (69.23%), Postives = 11/13 (84.62%), Query Frame = 3
Query:  444 CDNGGTFITCNYD 482
            C+NGG F+ CNYD
Sbjct:  139 CNNGGYFVGCNYD 151          
BLAST of CD858816 vs. TAIR peptide
Match: AT4G33730.1 (| Symbols: | CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein | chr4:16185098-16185616 FORWARD LENGTH=172)

HSP 1 Score: 102.449 bits (254), Expect = 1.622e-26
Identity = 56/117 (47.86%), Postives = 69/117 (58.97%), Query Frame = 1
Query:   82 SHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQRKD--CQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            S    + + P  Y+  HNAAR+ V V  + WD  +A  AQ+YAN      C L HS G   YGEN+A  +G MS   AV +WV+EKS YD+ SN+C  G  CGHYT VV   SARLG
Sbjct:   30 SQYPQSHEYPDSYLRPHNAARAAVKVKPLRWDFGIATVAQDYANHLASGPCSLEHSSGP--YGENLAFGSGDMSAAQAVAMWVHEKSYYDFYSNSC-HGPACGHYTQVVWRGSARLG 143          

HSP 2 Score: 33.8834 bits (76), Expect = 1.622e-26
Identity = 10/19 (52.63%), Postives = 14/19 (73.68%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            C+NG + + CNYDP G Y+
Sbjct:  149 CNNGASIVVCNYDPAGNYI 167          
BLAST of CD858816 vs. TAIR peptide
Match: AT2G19990.1 (| Symbols: PR-1-LIKE | pathogenesis-related protein-1-like | chr2:8630065-8630595 REVERSE LENGTH=176)

HSP 1 Score: 108.612 bits (270), Expect = 4.650e-26
Identity = 55/119 (46.22%), Postives = 75/119 (63.03%), Query Frame = 1
Query:  109 PADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQR-KDCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG----MCHTDHVI 450
            P + +  HN AR+ VGV  +VW+ T+A +AQ+YA++R +DC + HS G   +GEN+A   G MSG  A + W+ EK +YDY+SNTC    VCGHYT +V  +S RLG     C  D  I
Sbjct:   42 PQETLVVHNKARAMVGVGPMVWNETLATYAQSYAHERARDCAMKHSLGP--FGENLAAGWGTMSGPVATEYWMTEKENYDYDSNTCGGDGVCGHYTQIVWRDSVRLGCASVRCKNDEYI 158          

HSP 2 Score: 26.1794 bits (56), Expect = 4.650e-26
Identity = 7/13 (53.85%), Postives = 11/13 (84.62%), Query Frame = 3
Query:  462 FITCNYDPPGTYV 500
            ++ C+YDPPG Y+
Sbjct:  159 WVICSYDPPGNYI 171          
BLAST of CD858816 vs. TAIR peptide
Match: AT2G14580.1 (| Symbols: ATPRB1, PRB1 | basic pathogenesis-related protein 1 | chr2:6225703-6226188 REVERSE LENGTH=161)

HSP 1 Score: 139.428 bits (350), Expect = 1.781e-39
Identity = 76/136 (55.88%), Postives = 98/136 (72.06%), Query Frame = 1
Query:   28 KMSSFSILCVLGLIFIVGSHVA--YAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQRK-DCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            K++S+S + ++ L  +VG+ V    AQDS  DYVNAHN ARSQ+GV  + WD  +AA+A+NYANQ K DC+L+HS   G YGEN+A S G +SG  AV LWVNEK++Y+Y++NTC    VCGHYT VV  NS RLG
Sbjct:    2 KVTSYSRILII-LAALVGALVVPLKAQDSQQDYVNAHNQARSQIGVGPMQWDEGLAAYARNYANQLKGDCRLVHS--RGPYGENLAKSGGDLSGVAAVNLWVNEKANYNYDTNTC--NGVCGHYTQVVWRNSVRLG 132          

HSP 2 Score: 40.4318 bits (93), Expect = 1.781e-39
Identity = 14/18 (77.78%), Postives = 16/18 (88.89%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTY 497
            C+NGGT I+CNYDPPG Y
Sbjct:  138 CNNGGTIISCNYDPPGNY 155          
BLAST of CD858816 vs. TAIR peptide
Match: AT4G33720.1 (| Symbols: | CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein | chr4:16182813-16183304 FORWARD LENGTH=163)

HSP 1 Score: 138.658 bits (348), Expect = 2.319e-39
Identity = 71/132 (53.79%), Postives = 91/132 (68.94%), Query Frame = 1
Query:   34 SSFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQRK-DCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            SS ++   +    ++  H+  AQDSP D++  HN AR++VGV  + WD  VAA+A+NYANQRK DC + HS G   YGENIA S+G M+G  AV +WV+E+ DYDY+SNTCA  K CGHYT VV  NS RLG
Sbjct:    6 SSQNLFLAITFFLVLIVHLK-AQDSPQDFLAVHNRARAEVGVGPLRWDEKVAAYARNYANQRKGDCAMKHSSGS--YGENIAWSSGSMTGVAAVDMWVDEQFDYDYDSNTCAWDKQCGHYTQVVWRNSERLG 134          

HSP 2 Score: 40.817 bits (94), Expect = 2.319e-39
Identity = 15/19 (78.95%), Postives = 17/19 (89.47%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            C+NG TFITCNYDPPG +V
Sbjct:  140 CNNGQTFITCNYDPPGNWV 158          
BLAST of CD858816 vs. TAIR peptide
Match: AT5G26130.1 (| Symbols: | CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein | chr5:9128110-9128610 REVERSE LENGTH=166)

HSP 1 Score: 133.265 bits (334), Expect = 3.264e-38
Identity = 69/128 (53.91%), Postives = 84/128 (65.62%), Query Frame = 1
Query:   46 ILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQRK-DCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            IL V+ ++F+  +    AQD P DY++ HN AR+QVGV  + W      +A NYA QRK DC L HS   G YGEN+A S G +SG +AVKLWVNEKSDY Y SNTC+ GK CGHYT VV   S  +G
Sbjct:   11 ILSVI-VLFLAFAVPLKAQDQPQDYLDEHNRARTQVGVPPMKWHAGAEQYAWNYAQQRKGDCSLTHSNSNGLYGENLAWSGGALSGAEAVKLWVNEKSDYIYASNTCSDGKQCGHYTQVVWRTSEWVG 137          

HSP 2 Score: 42.3578 bits (98), Expect = 3.264e-38
Identity = 15/18 (83.33%), Postives = 16/18 (88.89%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTY 497
            CDNGGTF+TCNY PPG Y
Sbjct:  143 CDNGGTFVTCNYYPPGNY 160          
BLAST of CD858816 vs. TAIR peptide
Match: AT4G33710.1 (| Symbols: | CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein | chr4:16181065-16181565 FORWARD LENGTH=166)

HSP 1 Score: 130.954 bits (328), Expect = 4.958e-36
Identity = 69/128 (53.91%), Postives = 83/128 (64.84%), Query Frame = 1
Query:   49 LCVLGLIFIVGSHVAY-AQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQRK-DCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            L +L L  ++   V   AQD   DY++ HN AR  V V +I W    A +A NYA +RK DC+LIHS   GRYGEN+A S+G MSG  AV+LWV EKSDY + SNTC AGK CGHYT VV  NS  +G
Sbjct:   10 LVLLALALVLAFAVPLKAQDRRQDYLDVHNHARDDVSVPHIKWHAGAARYAWNYAQRRKRDCRLIHSNSRGRYGENLAWSSGDMSGAAAVRLWVREKSDYFHKSNTCRAGKQCGHYTQVVWKNSEWVG 137          

HSP 2 Score: 37.3502 bits (85), Expect = 4.958e-36
Identity = 13/16 (81.25%), Postives = 14/16 (87.50%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPG 491
            CDNGGTF+TCNY  PG
Sbjct:  143 CDNGGTFVTCNYSHPG 158          
BLAST of CD858816 vs. TAIR peptide
Match: AT3G19690.1 (| Symbols: | CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein | chr3:6842365-6842850 REVERSE LENGTH=161)

HSP 1 Score: 124.79 bits (312), Expect = 4.962e-36
Identity = 66/131 (50.38%), Postives = 87/131 (66.41%), Query Frame = 1
Query:   43 SILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQR-KDCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTC--AAGKVCGHYTHVVRTNSARLG 426
            +IL +L +    GS    A+D    ++ AHN AR++VG+  +VWD+ VAA+A +YANQR  DC L+HS G   +GENIAMS+G MS  DA ++W+NEK  YDY+SNTC    G  C HYT VV  N+ RLG
Sbjct:    7 NILFLLAIALFYGS---LAEDLQQQFLEAHNEARNEVGLDPLVWDDEVAAYAASYANQRINDCALVHSNGP--FGENIAMSSGEMSAEDAAEMWINEKQYYDYDSNTCNDPNGGTCLHYTQVVWKNTVRLG 132          

HSP 2 Score: 43.5134 bits (101), Expect = 4.962e-36
Identity = 15/19 (78.95%), Postives = 18/19 (94.74%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            C++GGTFITCNYDPPG Y+
Sbjct:  138 CNSGGTFITCNYDPPGNYI 156          
BLAST of CD858816 vs. TAIR peptide
Match: AT2G14610.1 (| Symbols: PR1, PR 1, ATPR1 | pathogenesis-related gene 1 | chr2:6241944-6242429 REVERSE LENGTH=161)

HSP 1 Score: 124.02 bits (310), Expect = 2.613e-34
Identity = 65/123 (52.85%), Postives = 85/123 (69.11%), Query Frame = 1
Query:   67 IFIVGSHV--AYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQ-RKDCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            + +VG+ V  + AQDSP DY+  HN AR  VGV  + WD  VAA+A++YA Q R +C+LIHSGG   YGEN+A  +G +SG  AV +WV+EK++Y+Y +NTC    VCGHYT VV   S RLG
Sbjct:   14 VALVGALVLPSKAQDSPQDYLRVHNQARGAVGVGPMQWDERVAAYARSYAEQLRGNCRLIHSGGP--YGENLAWGSGDLSGVSAVNMWVSEKANYNYAANTC--NGVCGHYTQVVWRKSVRLG 132          

HSP 2 Score: 38.5058 bits (88), Expect = 2.613e-34
Identity = 14/19 (73.68%), Postives = 16/19 (84.21%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            C+NGGT I+CNYDP G YV
Sbjct:  138 CNNGGTIISCNYDPRGNYV 156          
BLAST of CD858816 vs. TAIR peptide
Match: AT1G50060.1 (| Symbols: | CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein | chr1:18551186-18552446 FORWARD LENGTH=161)

HSP 1 Score: 125.176 bits (313), Expect = 2.508e-31
Identity = 65/128 (50.78%), Postives = 86/128 (67.19%), Query Frame = 1
Query:   49 LCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQRK-DCQLIHSGGGGRYGENIAM-STGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            L ++ + F+V +    AQ++P DY+N+HN AR+QVGV N+VWD T+AA+A NY+N RK DC L+HS   G YGEN+A  S+   S   AVKLWV+EK  Y Y  N C  GK C HYT VV  +S ++G
Sbjct:    9 LVIVAISFLVVA--TNAQNTPQDYLNSHNTARAQVGVPNVVWDTTLAAYALNYSNFRKADCNLVHS--NGPYGENLAKGSSSSFSAISAVKLWVDEKPYYSYAYNNCTGGKQCLHYTQVVWRDSVKIG 132          

HSP 2 Score: 27.335 bits (59), Expect = 2.508e-31
Identity = 9/19 (47.37%), Postives = 13/19 (68.42%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            C N   F++CNY+ PG +V
Sbjct:  138 CTNTWWFVSCNYNSPGNWV 156          
BLAST of CD858816 vs. TAIR peptide
Match: AT1G50050.1 (| Symbols: | CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein | chr1:18546165-18549046 FORWARD LENGTH=226)

HSP 1 Score: 121.709 bits (304), Expect = 1.579e-30
Identity = 63/128 (49.22%), Postives = 84/128 (65.62%), Query Frame = 1
Query:   49 LCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQRK-DCQLIHSGGGGRYGENIAMSTGGM-SGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            L ++ + F+V +    AQ++  DY+N HN AR+QVGV+N+VWD  VAA+A NYAN RK DC L  S GG  YGEN+A     + +G  AV LWVNEK  Y+Y +N C   + C HYT VV +NS ++G
Sbjct:    9 LIIVAISFLVLA--TNAQNAQQDYLNTHNTARAQVGVANVVWDTVVAAYATNYANARKVDCSLTPSTGGS-YGENLANGNNALFTGVAAVNLWVNEKPYYNYTANACIGAQQCKHYTQVVWSNSVKIG 133          

HSP 2 Score: 28.1054 bits (61), Expect = 1.579e-30
Identity = 9/13 (69.23%), Postives = 11/13 (84.62%), Query Frame = 3
Query:  444 CDNGGTFITCNYD 482
            C+NGG F+ CNYD
Sbjct:  139 CNNGGYFVGCNYD 151          
BLAST of CD858816 vs. TAIR peptide
Match: AT4G33730.1 (| Symbols: | CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein | chr4:16185098-16185616 FORWARD LENGTH=172)

HSP 1 Score: 102.449 bits (254), Expect = 1.622e-26
Identity = 56/117 (47.86%), Postives = 69/117 (58.97%), Query Frame = 1
Query:   82 SHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQRKD--CQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            S    + + P  Y+  HNAAR+ V V  + WD  +A  AQ+YAN      C L HS G   YGEN+A  +G MS   AV +WV+EKS YD+ SN+C  G  CGHYT VV   SARLG
Sbjct:   30 SQYPQSHEYPDSYLRPHNAARAAVKVKPLRWDFGIATVAQDYANHLASGPCSLEHSSGP--YGENLAFGSGDMSAAQAVAMWVHEKSYYDFYSNSC-HGPACGHYTQVVWRGSARLG 143          

HSP 2 Score: 33.8834 bits (76), Expect = 1.622e-26
Identity = 10/19 (52.63%), Postives = 14/19 (73.68%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            C+NG + + CNYDP G Y+
Sbjct:  149 CNNGASIVVCNYDPAGNYI 167          
BLAST of CD858816 vs. TAIR peptide
Match: AT2G19990.1 (| Symbols: PR-1-LIKE | pathogenesis-related protein-1-like | chr2:8630065-8630595 REVERSE LENGTH=176)

HSP 1 Score: 108.612 bits (270), Expect = 4.650e-26
Identity = 55/119 (46.22%), Postives = 75/119 (63.03%), Query Frame = 1
Query:  109 PADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQR-KDCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG----MCHTDHVI 450
            P + +  HN AR+ VGV  +VW+ T+A +AQ+YA++R +DC + HS G   +GEN+A   G MSG  A + W+ EK +YDY+SNTC    VCGHYT +V  +S RLG     C  D  I
Sbjct:   42 PQETLVVHNKARAMVGVGPMVWNETLATYAQSYAHERARDCAMKHSLGP--FGENLAAGWGTMSGPVATEYWMTEKENYDYDSNTCGGDGVCGHYTQIVWRDSVRLGCASVRCKNDEYI 158          

HSP 2 Score: 26.1794 bits (56), Expect = 4.650e-26
Identity = 7/13 (53.85%), Postives = 11/13 (84.62%), Query Frame = 3
Query:  462 FITCNYDPPGTYV 500
            ++ C+YDPPG Y+
Sbjct:  159 WVICSYDPPGNYI 171          
BLAST of CD858816 vs. TrEMBL
Match: C6T1I7_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 5.291e-54
Identity = 99/131 (75.57%), Postives = 110/131 (83.97%), Query Frame = 1
Query:   37 SFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQRK-DCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            S  +LCVLGL+ IVG HVAYAQDSP DYVNAHNAARSQVGV NIVWDN VAAFAQNYANQRK DC+L+HSGG G+YGEN+A STG +SG DAV+LWVNEKS Y+YNSN+C  G+ C HYT VV  NS RLG
Sbjct:    7 SLCLLCVLGLV-IVGDHVAYAQDSPTDYVNAHNAARSQVGVPNIVWDNAVAAFAQNYANQRKGDCKLVHSGGDGKYGENLAGSTGNLSGKDAVQLWVNEKSKYNYNSNSCVGGE-CLHYTQVVWRNSLRLG 135          

HSP 2 Score: 36.5798 bits (83), Expect = 5.291e-54
Identity = 13/19 (68.42%), Postives = 15/19 (78.95%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            C+NGGT I CNY PPG Y+
Sbjct:  141 CNNGGTSIGCNYAPPGNYI 159          
BLAST of CD858816 vs. TrEMBL
Match: C6T1N0_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 1.362e-48
Identity = 92/140 (65.71%), Postives = 110/140 (78.57%), Query Frame = 1
Query:   37 SFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVG---------VSNIVWDNTVAAFAQNYANQRK-DCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            SF ++CVLGL+ IVG  VAYAQDS  DYVNAHNAAR++VG         V ++ WD+TVAA+A++YANQRK DCQLIHSGG   YGENIAMSTG +SGTDAVK+WV+EKS+YDY+SN+C  G+ C HYT VV  NS RLG
Sbjct:    9 SFCVMCVLGLV-IVGD-VAYAQDSAEDYVNAHNAARAEVGSQSPRQTVIVPSLAWDDTVAAYAESYANQRKGDCQLIHSGG--EYGENIAMSTGELSGTDAVKMWVDEKSNYDYDSNSCVGGE-CLHYTQVVWANSVRLG 143          

HSP 2 Score: 46.2098 bits (108), Expect = 1.362e-48
Identity = 17/19 (89.47%), Postives = 18/19 (94.74%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            CDNGGTFITCNYDPPG +V
Sbjct:  149 CDNGGTFITCNYDPPGNFV 167          
BLAST of CD858816 vs. TrEMBL
Match: Q9XFB4_SOYBN (PR1a OS=Glycine max GN=PR1a PE=2 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 5.563e-47
Identity = 90/140 (64.29%), Postives = 108/140 (77.14%), Query Frame = 1
Query:   37 SFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVG---------VSNIVWDNTVAAFAQNYANQRK-DCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            SF ++CVLGL+ IVG  VAYAQDS  DYVNAHNAA ++VG         V ++ WD+TVAA+A++YANQRK DCQLIHSGG   YGENIAMSTG +SGTDAVK+WV+EKS+ DY+SN+C  G+ C HYT VV  NS RLG
Sbjct:    9 SFCVMCVLGLV-IVGD-VAYAQDSAEDYVNAHNAAEAEVGSQSPRQTVIVPSLAWDDTVAAYAESYANQRKGDCQLIHSGG--EYGENIAMSTGELSGTDAVKMWVDEKSNCDYDSNSCVGGE-CLHYTQVVWANSVRLG 143          

HSP 2 Score: 46.2098 bits (108), Expect = 5.563e-47
Identity = 17/19 (89.47%), Postives = 18/19 (94.74%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            CDNGGTFITCNYDPPG +V
Sbjct:  149 CDNGGTFITCNYDPPGNFV 167          
BLAST of CD858816 vs. TrEMBL
Match: B9S7U9_RICCO (STS14 protein, putative OS=Ricinus communis GN=RCOM_1381930 PE=4 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 3.563e-46
Identity = 84/131 (64.12%), Postives = 102/131 (77.86%), Query Frame = 1
Query:   37 SFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQR-KDCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            S ++  ++ L  I+ SH   AQ+ P DY+NAHNAAR+ VGV  + WDNTVAA+AQNYANQR  DC+L+HSGG  RYGENIA S+G +SGT AVKLWV+EK+ Y+YNSNTCAAG+ CGHYT VV  NS RLG
Sbjct:    7 SAALSFLISLSLILSSH---AQNLPQDYINAHNAARAAVGVGPMTWDNTVAAYAQNYANQRINDCRLVHSGG--RYGENIAWSSGDLSGTAAVKLWVDEKAFYNYNSNTCAAGQQCGHYTQVVWRNSVRLG 132          

HSP 2 Score: 43.1282 bits (100), Expect = 3.563e-46
Identity = 16/19 (84.21%), Postives = 17/19 (89.47%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            C NGGTFITCNYDPPG +V
Sbjct:  138 CRNGGTFITCNYDPPGNFV 156          
BLAST of CD858816 vs. TrEMBL
Match: B5QTD3_BETVU (Pathogenesis-related protein 1a OS=Beta vulgaris GN=pr1a PE=2 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 2.465e-44
Identity = 78/119 (65.55%), Postives = 94/119 (78.99%), Query Frame = 1
Query:   82 SHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQRK-DCQLIHSGGGGRYGENIAMSTGG---MSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            + + +AQ+SP DYVNAHN AR+ VGV NI WD+ VAAFAQ YA+QRK DC L HSGGGGRYGEN+A  +G    ++ T AV++WV EK+DYDYNSNTCA+GKVCGHYT VV  +S RLG
Sbjct:   21 AQMCHAQNSPQDYVNAHNDARAAVGVGNIQWDDQVAAFAQQYADQRKGDCVLQHSGGGGRYGENLAGGSGPGLVLTATTAVQMWVAEKADYDYNSNTCASGKVCGHYTQVVWRDSVRLG 139          

HSP 2 Score: 43.5134 bits (101), Expect = 2.465e-44
Identity = 15/19 (78.95%), Postives = 17/19 (89.47%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            CDNGG F+TCNYDPPG +V
Sbjct:  145 CDNGGIFVTCNYDPPGNFV 163          
BLAST of CD858816 vs. TrEMBL
Match: E2GEU0_9ROSI (Pathogenesis-related protein 1 OS=Vitis hybrid cultivar GN=PR-1 PE=4 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 9.284e-44
Identity = 79/131 (60.31%), Postives = 96/131 (73.28%), Query Frame = 1
Query:   37 SFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQR-KDCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            S   +CVLGL  +   H + AQ+S  DY+NAHN AR+QVGV ++ W+NTVA++AQNYANQR  DC L+HS   G YGENIA  +G ++GTDAV LWV EK +YDYNSN+C  GK CGHYT VV  NS RLG
Sbjct:    7 SLVFICVLGLALV---HTSCAQNSQQDYLNAHNTARAQVGVGSMTWNNTVASYAQNYANQRIGDCNLVHS--NGPYGENIAWGSGSLTGTDAVNLWVGEKPNYDYNSNSCVGGK-CGHYTQVVWRNSVRLG 131          

HSP 2 Score: 43.1282 bits (100), Expect = 9.284e-44
Identity = 16/19 (84.21%), Postives = 17/19 (89.47%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            C+NGG FITCNYDPPG YV
Sbjct:  137 CNNGGWFITCNYDPPGNYV 155          
BLAST of CD858816 vs. TrEMBL
Match: E2GEV3_9ROSI (Pathogenesis-related protein 1 OS=Vitis hybrid cultivar GN=PR-1 PE=4 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 1.210e-43
Identity = 79/129 (61.24%), Postives = 99/129 (76.74%), Query Frame = 1
Query:   43 SILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQR-KDCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            S+  ++GL+ +  +H   AQ+SP DYV+AHNAAR+QVGV +I W++TVAA+AQNYANQR  DC L+HS  GG YGEN+A  +G ++GTDAV LWV EKS YDYNSN+C  G+ CGHYT VV  NS RLG
Sbjct:    7 SLALLVGLLGLALAHTCCAQNSPQDYVDAHNAARAQVGVGSITWNDTVAAYAQNYANQRISDCNLVHS--GGPYGENLAKGSGSLTGTDAVNLWVGEKSYYDYNSNSCVGGE-CGHYTQVVWRNSVRLG 132          

HSP 2 Score: 39.6614 bits (91), Expect = 1.210e-43
Identity = 14/19 (73.68%), Postives = 16/19 (84.21%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            C+NG  F+TCNYDPPG YV
Sbjct:  138 CNNGWWFVTCNYDPPGNYV 156          
BLAST of CD858816 vs. TrEMBL
Match: E2GEU3_9ROSI (Pathogenesis-related protein 1 OS=Vitis hybrid cultivar GN=PR-1 PE=4 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 1.210e-43
Identity = 79/131 (60.31%), Postives = 96/131 (73.28%), Query Frame = 1
Query:   37 SFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQR-KDCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            S   +CVLGL  +   H + AQ+S  DY+NAHN AR+QVGV ++ W+NTVA++AQNYANQR  DC L+HS   G YGENIA  +G ++GTDAV LWV EK +YDYNSN+C  GK CGHYT VV  NS RLG
Sbjct:    7 SLVFICVLGLALV---HTSCAQNSQQDYLNAHNTARAQVGVGSMTWNNTVASYAQNYANQRIGDCNLVHS--NGPYGENIAWGSGSLTGTDAVNLWVGEKPNYDYNSNSCVGGK-CGHYTQVVWRNSVRLG 131          

HSP 2 Score: 42.743 bits (99), Expect = 1.210e-43
Identity = 15/19 (78.95%), Postives = 17/19 (89.47%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            C+NGG F+TCNYDPPG YV
Sbjct:  137 CNNGGWFVTCNYDPPGNYV 155          
BLAST of CD858816 vs. TrEMBL
Match: E2GET9_9ROSI (Pathogenesis-related protein 1 OS=Vitis hybrid cultivar GN=PR-1 PE=4 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 1.577e-43
Identity = 79/131 (60.31%), Postives = 96/131 (73.28%), Query Frame = 1
Query:   37 SFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQR-KDCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            S   +CVLGL  +   H + AQ+S  DY+NAHN AR+QVGV ++ W+NTVA++AQNYANQR  DC L+HS   G YGENIA  +G ++GTDAV LWV EK +YDYNSN+C  GK CGHYT VV  NS RLG
Sbjct:    7 SLVFICVLGLALV---HTSCAQNSQQDYLNAHNTARAQVGVGSMTWNNTVASYAQNYANQRIGDCNLVHS--NGPYGENIAWGSGSLTGTDAVDLWVGEKPNYDYNSNSCVGGK-CGHYTQVVWRNSVRLG 131          

HSP 2 Score: 42.743 bits (99), Expect = 1.577e-43
Identity = 15/19 (78.95%), Postives = 17/19 (89.47%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            C+NGG F+TCNYDPPG YV
Sbjct:  137 CNNGGWFVTCNYDPPGNYV 155          
BLAST of CD858816 vs. TrEMBL
Match: Q00MX6_MALDO (Pathogenesis-related protein 1a OS=Malus domestica PE=2 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 4.547e-43
Identity = 79/131 (60.31%), Postives = 96/131 (73.28%), Query Frame = 1
Query:   37 SFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQRK-DCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            S ++L +LG + I  SH   AQD+P DY+ +HN AR+ VGV  + WD+ VA +AQNYANQ   DC L+HSGG   YGEN+AMSTG MSGT AV +WV EK+DY Y SN+CA GKVCGHYT VV  NSAR+G
Sbjct:    7 SLALLFILGSVLIQSSH---AQDTPQDYLKSHNDARAAVGVGPLTWDDKVAGYAQNYANQHVGDCNLVHSGGP--YGENLAMSTGDMSGTAAVDMWVAEKADYSYESNSCADGKVCGHYTQVVWRNSARVG 132          

HSP 2 Score: 40.817 bits (94), Expect = 4.547e-43
Identity = 15/19 (78.95%), Postives = 16/19 (84.21%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            C +GGTFI CNYDPPG YV
Sbjct:  138 CSSGGTFIGCNYDPPGNYV 156          
BLAST of CD858816 vs. Lotus protein
Match: LjSGA_029184.1 (+ phase: 0 )

HSP 1 Score: 113.235 bits (282), Expect = 3.838e-29
Identity = 58/122 (47.54%), Postives = 77/122 (63.11%), Query Frame = 1
Query:   64 LIFIVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQ-RKDCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            L  +  S   YAQDSPADY+ A N  RS  GV+ +VWD  +A + +NY N+ R  C++ HS  GG Y EN+A     ++GT AV +WVNE   YDYNSN+C  G+ C HYT VV  ++ R+G
Sbjct:   16 LAIVTFSQTGYAQDSPADYLEAQNRFRSYAGVAPLVWDQNLANYGKNYLNRFRGSCEMEHS-QGGPYTENLAWGFPDLTGTAAVDMWVNEWPHYDYNSNSCIGGE-CRHYTQVVWRDTLRVG 135          

HSP 2 Score: 31.187 bits (69), Expect = 3.838e-29
Identity = 12/20 (60.00%), Postives = 14/20 (70.00%), Query Frame = 3
Query:  444 CDNG-GTFITCNYDPPGTYV 500
            CDN  GT I+C YDP G Y+
Sbjct:  141 CDNNRGTLISCTYDPKGNYI 160          
BLAST of CD858816 vs. Lotus protein
Match: LjSGA_134572.1 (- phase: 0 )

HSP 1 Score: 102.449 bits (254), Expect = 4.135e-28
Identity = 54/130 (41.54%), Postives = 79/130 (60.77%), Query Frame = 1
Query:   46 ILCVLGLIFIVGSHVAYAQD--SPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQRK-DCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            ++ +L + F +   ++ A +  SP ++++ HN AR++VGV  + W++ + A+AQNYA+ R  DC L HS G   YGENIA   G M   DA KLW  EK +YD  SN+C   + C HYT +V  +S  LG
Sbjct:    9 VMMILAIFFFMSCTISLAHEVCSPKEFLDVHNQARAEVGVGPLSWNHNLEAYAQNYADLRSHDCNLEHSNGP--YGENIAEGYGEMKDADAAKLWFAEKPNYDPQSNSCVNDE-CLHYTQMVWRDSVHLG 135          

HSP 2 Score: 38.5058 bits (88), Expect = 4.135e-28
Identity = 13/19 (68.42%), Postives = 15/19 (78.95%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            C+NG  F+ CNYDPPG YV
Sbjct:  141 CNNGWVFVVCNYDPPGNYV 159          
BLAST of CD858816 vs. Lotus protein
Match: LjSGA_032971.1 (- phase: 1 /pseudo/partial)

HSP 1 Score: 115.161 bits (287), Expect = 1.195e-26
Identity = 53/88 (60.23%), Postives = 69/88 (78.41%), Query Frame = 1
Query:  166 IVWDNTVAAFAQNYANQRK-DCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            ++   T+    ++YANQR+ DC LIHSGGGGRYGEN+A  T  +SGTDAVK+WV+E+++YDY+SN+CA G+ CGHYT VV  NS RLG
Sbjct:   54 LLLQRTMPINVEDYANQRQGDCNLIHSGGGGRYGENLAWGTLDLSGTDAVKMWVDEQANYDYDSNSCADGEQCGHYTQVVWENSMRLG 141          
BLAST of CD858816 vs. Lotus protein
Match: chr5.CM0696.210.r2.m (+ phase: 0 )

HSP 1 Score: 77.7962 bits (190), Expect = 2.236e-17
Identity = 42/114 (36.84%), Postives = 68/114 (59.65%), Query Frame = 1
Query:  115 DYVNAHNAARSQVGVSNIVWDNTVAAFAQNY--ANQRKDCQLIHSGGGGRYGENIAMSTG-GMSGTDAVKLWVNEKSDYDYNSNTCA-AGKVCGHYTHVVRTNSARLGMCHTDH 444
            ++++AHN  R+Q  + N+ WD+ +A +A+ Y   ++  DC+LIHS     YGEN+        + +DAV  W  EK  +D+N+  CA A K+CGH+T +V  ++ R+G C   H
Sbjct:   84 EFLHAHNWVRTQYNLPNLTWDDNLAGYARQYLTTDRYDDCKLIHS--NATYGENMFWGKKLHWTPSDAVYYWYIEKDAFDFNTLKCAPASKMCGHFTQLVWRDTTRVG-CALQH 194          

HSP 2 Score: 26.9498 bits (58), Expect = 2.236e-17
Identity = 9/14 (64.29%), Postives = 9/14 (64.29%), Query Frame = 3
Query:  456 GTFITCNYDPPGTY 497
            G  I C YDPPG Y
Sbjct:  201 GMLIACEYDPPGNY 214          
BLAST of CD858816 vs. Lotus protein
Match: chr2.CM0323.230.r2.m (+ phase: 0 )

HSP 1 Score: 69.707 bits (169), Expect = 5.759e-13
Identity = 44/135 (32.59%), Postives = 70/135 (51.85%), Query Frame = 1
Query:   73 IVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQRKD---CQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKV-CGHYTHVVRTNSARLG----MCHTDHVIM 453
            ++ S V        ++++AHN AR++VGV  + W   +A  A  +A  ++D   C+L +     +YG N  +   G + + AV+ WVNEK  Y Y +N+C A    C HYT VV   S ++G     C  D +I+
Sbjct:   25 VLDSVVPQLSAEAKEFLDAHNWARAEVGVEPLEWSEALAKDAGLFARYQRDRLGCKLANFSHN-KYGSNQDLGGMGWTPSVAVQDWVNEKEFYSYRTNSCVAPSFPCWHYTQVVWRKSKQVGCAQLTCVVDKLIL 158          
BLAST of CD858816 vs. Lotus protein
Match: chr4.CM0165.120.r2.d (+ phase: 0 )

HSP 1 Score: 61.6178 bits (148), Expect = 4.918e-12
Identity = 34/108 (31.48%), Postives = 55/108 (50.93%), Query Frame = 1
Query:  115 DYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQRKD---CQLIHSGGGGRYGENIAMSTGG-MSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            D+++AHN AR  VGV  + W   +A+     A  ++D   CQ  +   G +YG N   + G  ++    V+ WV++K  Y++  NTC     CG YT +V   +  +G
Sbjct:   34 DFLDAHNEARGSVGVQPLRWSPQLASTTSRLARYQRDKTGCQFANLTAG-KYGANQLRALGAAVTPRMVVEEWVSQKQFYNHTDNTCVPNHRCGVYTQIVWRKTVEVG 140          

HSP 2 Score: 25.0238 bits (53), Expect = 4.918e-12
Identity = 11/20 (55.00%), Postives = 12/20 (60.00%), Query Frame = 3
Query:  444 CDNGGTFIT-CNYDPPGTYV 500
            CD  G  +T C Y PPG YV
Sbjct:  146 CDKEGASLTICFYYPPGNYV 165          
BLAST of CD858816 vs. Lotus protein
Match: chr2.CM0323.250.r2.m (+ phase: 0 /pseudo/partial)

HSP 1 Score: 56.225 bits (134), Expect = 3.277e-9
Identity = 36/121 (29.75%), Postives = 55/121 (45.45%), Query Frame = 1
Query:  115 DYVNAHNAARSQVGVSNIVWDNTV---AAFAQNYANQRKDCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLGMCHTDHVIMEELSL 468
            +++ AHN AR+ VGV  + W   +   A+    Y   +  C   +       G  I   +  ++   AV  WV EK  Y + +N+C A   CG YT VV  +S  +G C     + E+ SL
Sbjct:   46 EFLEAHNQARAAVGVEPLEWSEKLGKDASLFVRYQRNKFGCGFANLTDSEYGGNQIMAGSVSVAPRVAVAEWVKEKDFYIHANNSCVAEHECGVYTQVVWRDSKEVG-CSQASCVKEKASL 165          

HSP 2 Score: 20.7866 bits (42), Expect = 3.277e-9
Identity = 7/10 (70.00%), Postives = 7/10 (70.00%), Query Frame = 3
Query:  471 CNYDPPGTYV 500
            C YDPPG  V
Sbjct:  168 CFYDPPGNVV 177          
BLAST of CD858816 vs. Lotus protein
Match: chr2.CM0323.240.r2.m (+ phase: 0 )

HSP 1 Score: 51.2174 bits (121), Expect = 2.120e-7
Identity = 36/141 (25.53%), Postives = 62/141 (43.97%), Query Frame = 1
Query:   40 FSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVGVS-NIVWDNTVAAFAQNYANQRKDCQLIHSG--GGGRYG----ENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLGMCHTD 441
            F++L  L L+ +         D    Y+  HN  R + G+S ++ W + +A  A  YA  R+D  L   G     RYG    + +  +   M   + ++ WV ++  Y+ N++   A   CG YT +V   +  LG    +
Sbjct:    7 FAVLVALALLLVSSQATPATTDGAKVYLFEHNFVRREKGISEHLEWSDKLAKDASLYARFRRDKYLCTPGIFDKKRYGVCCNQWLEDTVKIMDPREVMRQWVKDRFYYEGNNSCVPANYPCGDYTQIVWRKTKYLGCAQAE 147          
BLAST of CD858816 vs. Soybean peptides
Match: Glyma15g06780.1|PACid:16297881 ()

HSP 1 Score: 206.068 bits (523), Expect = 1.780e-60
Identity = 102/131 (77.86%), Postives = 115/131 (87.79%), Query Frame = 1
Query:   37 SFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQRK-DCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            SF +LCVLGL+ IV SHVA AQDSPADYVNAHNAARS+VGV N+ WD+TVAAFAQNYANQRK DCQLIHSGGGG+YGEN+AMSTG +SGTDAVKLWV+EKS+YDYNSN+C  G+ C HYT VV  +S RLG
Sbjct:    7 SFPVLCVLGLVMIV-SHVANAQDSPADYVNAHNAARSEVGVQNLAWDDTVAAFAQNYANQRKGDCQLIHSGGGGQYGENLAMSTGDLSGTDAVKLWVDEKSNYDYNSNSCVGGE-CLHYTQVVWRDSVRLG 135          

HSP 2 Score: 44.669 bits (104), Expect = 1.780e-60
Identity = 17/19 (89.47%), Postives = 17/19 (89.47%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            CDNGGTFITCNY PPG YV
Sbjct:  141 CDNGGTFITCNYAPPGNYV 159          
BLAST of CD858816 vs. Soybean peptides
Match: Glyma15g06800.1|PACid:16297883 ()

HSP 1 Score: 204.142 bits (518), Expect = 6.707e-60
Identity = 100/131 (76.34%), Postives = 113/131 (86.26%), Query Frame = 1
Query:   37 SFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQRK-DCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            SFS+LC+LGL+ IVG H AYAQDSP D+VNAHNAARSQVGV NIVWD+TVAAFAQNYANQRK DC+L+HSGG G+YGEN+A STG +SGT+AVKLWV+EKS YDYNSNTC  G+ C HYT VV  NS RLG
Sbjct:    8 SFSVLCLLGLV-IVGDHAAYAQDSPTDFVNAHNAARSQVGVPNIVWDDTVAAFAQNYANQRKGDCKLVHSGGDGKYGENLAGSTGNLSGTNAVKLWVDEKSKYDYNSNTCVGGE-CRHYTQVVWKNSVRLG 136          

HSP 2 Score: 44.669 bits (104), Expect = 6.707e-60
Identity = 17/19 (89.47%), Postives = 17/19 (89.47%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            CDNGGTFITCNY PPG YV
Sbjct:  142 CDNGGTFITCNYAPPGNYV 160          
BLAST of CD858816 vs. Soybean peptides
Match: Glyma15g06790.1|PACid:16297882 ()

HSP 1 Score: 199.134 bits (505), Expect = 6.631e-57
Identity = 99/131 (75.57%), Postives = 110/131 (83.97%), Query Frame = 1
Query:   37 SFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQRK-DCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            S  +LCVLGL+ IVG HVAYAQDSP DYVNAHNAARSQVGV NIVWDN VAAFAQNYANQRK DC+L+HSGG G+YGEN+A STG +SG DAV+LWVNEKS Y+YNSN+C  G+ C HYT VV  NS RLG
Sbjct:    7 SLCLLCVLGLV-IVGDHVAYAQDSPTDYVNAHNAARSQVGVPNIVWDNAVAAFAQNYANQRKGDCKLVHSGGDGKYGENLAGSTGNLSGKDAVQLWVNEKSKYNYNSNSCVGGE-CLHYTQVVWRNSLRLG 135          

HSP 2 Score: 39.6614 bits (91), Expect = 6.631e-57
Identity = 14/19 (73.68%), Postives = 16/19 (84.21%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            C+NGGTFI CNY PPG Y+
Sbjct:  141 CNNGGTFIGCNYAPPGNYI 159          
BLAST of CD858816 vs. Soybean peptides
Match: Glyma13g32540.1|PACid:16292371 ()

HSP 1 Score: 171.4 bits (433), Expect = 1.424e-50
Identity = 92/140 (65.71%), Postives = 110/140 (78.57%), Query Frame = 1
Query:   37 SFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVG---------VSNIVWDNTVAAFAQNYANQRK-DCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            SF ++CVLGL+ IVG  VAYAQDS  DYVNAHNAAR++VG         V ++ WD+TVAA+A++YANQRK DCQLIHSGG   YGENIAMSTG +SGTDAVK+WV+EKS+YDY+SN+C  G+ C HYT VV  NS RLG
Sbjct:    9 SFCVMCVLGLV-IVGD-VAYAQDSAEDYVNAHNAARAEVGSQSPRQTVIVPSLAWDDTVAAYAESYANQRKGDCQLIHSGG--EYGENIAMSTGELSGTDAVKMWVDEKSNYDYDSNSCVGGE-CLHYTQVVWANSVRLG 143          

HSP 2 Score: 46.2098 bits (108), Expect = 1.424e-50
Identity = 17/19 (89.47%), Postives = 18/19 (94.74%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            CDNGGTFITCNYDPPG +V
Sbjct:  149 CDNGGTFITCNYDPPGNFV 167          
BLAST of CD858816 vs. Soybean peptides
Match: Glyma13g32530.1|PACid:16292370 ()

HSP 1 Score: 171.4 bits (433), Expect = 1.424e-50
Identity = 92/140 (65.71%), Postives = 110/140 (78.57%), Query Frame = 1
Query:   37 SFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVG---------VSNIVWDNTVAAFAQNYANQRK-DCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            SF ++CVLGL+ IVG  VAYAQDS  DYVNAHNAAR++VG         V ++ WD+TVAA+A++YANQRK DCQLIHSGG   YGENIAMSTG +SGTDAVK+WV+EKS+YDY+SN+C  G+ C HYT VV  NS RLG
Sbjct:    9 SFCVMCVLGLV-IVGD-VAYAQDSAEDYVNAHNAARAEVGSQSPRQTVIVPSLAWDDTVAAYAESYANQRKGDCQLIHSGG--EYGENIAMSTGELSGTDAVKMWVDEKSNYDYDSNSCVGGE-CLHYTQVVWANSVRLG 143          

HSP 2 Score: 46.2098 bits (108), Expect = 1.424e-50
Identity = 17/19 (89.47%), Postives = 18/19 (94.74%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            CDNGGTFITCNYDPPG +V
Sbjct:  149 CDNGGTFITCNYDPPGNFV 167          
BLAST of CD858816 vs. Soybean peptides
Match: Glyma13g32520.1|PACid:16292369 ()

HSP 1 Score: 171.4 bits (433), Expect = 1.424e-50
Identity = 92/140 (65.71%), Postives = 110/140 (78.57%), Query Frame = 1
Query:   37 SFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVG---------VSNIVWDNTVAAFAQNYANQRK-DCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            SF ++CVLGL+ IVG  VAYAQDS  DYVNAHNAAR++VG         V ++ WD+TVAA+A++YANQRK DCQLIHSGG   YGENIAMSTG +SGTDAVK+WV+EKS+YDY+SN+C  G+ C HYT VV  NS RLG
Sbjct:    9 SFCVMCVLGLV-IVGD-VAYAQDSAEDYVNAHNAARAEVGSQSPRQTVIVPSLAWDDTVAAYAESYANQRKGDCQLIHSGG--EYGENIAMSTGELSGTDAVKMWVDEKSNYDYDSNSCVGGE-CLHYTQVVWANSVRLG 143          

HSP 2 Score: 46.2098 bits (108), Expect = 1.424e-50
Identity = 17/19 (89.47%), Postives = 18/19 (94.74%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            CDNGGTFITCNYDPPG +V
Sbjct:  149 CDNGGTFITCNYDPPGNFV 167          
BLAST of CD858816 vs. Soybean peptides
Match: Glyma13g32510.1|PACid:16292368 ()

HSP 1 Score: 171.4 bits (433), Expect = 1.424e-50
Identity = 92/140 (65.71%), Postives = 110/140 (78.57%), Query Frame = 1
Query:   37 SFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVG---------VSNIVWDNTVAAFAQNYANQRK-DCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            SF ++CVLGL+ IVG  VAYAQDS  DYVNAHNAAR++VG         V ++ WD+TVAA+A++YANQRK DCQLIHSGG   YGENIAMSTG +SGTDAVK+WV+EKS+YDY+SN+C  G+ C HYT VV  NS RLG
Sbjct:    9 SFCVMCVLGLV-IVGD-VAYAQDSAEDYVNAHNAARAEVGSQSPRQTVIVPSLAWDDTVAAYAESYANQRKGDCQLIHSGG--EYGENIAMSTGELSGTDAVKMWVDEKSNYDYDSNSCVGGE-CLHYTQVVWANSVRLG 143          

HSP 2 Score: 46.2098 bits (108), Expect = 1.424e-50
Identity = 17/19 (89.47%), Postives = 18/19 (94.74%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            CDNGGTFITCNYDPPG +V
Sbjct:  149 CDNGGTFITCNYDPPGNFV 167          
BLAST of CD858816 vs. Soybean peptides
Match: Glyma13g32500.1|PACid:16292367 ()

HSP 1 Score: 171.4 bits (433), Expect = 1.424e-50
Identity = 92/140 (65.71%), Postives = 110/140 (78.57%), Query Frame = 1
Query:   37 SFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVG---------VSNIVWDNTVAAFAQNYANQRK-DCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            SF ++CVLGL+ IVG  VAYAQDS  DYVNAHNAAR++VG         V ++ WD+TVAA+A++YANQRK DCQLIHSGG   YGENIAMSTG +SGTDAVK+WV+EKS+YDY+SN+C  G+ C HYT VV  NS RLG
Sbjct:    9 SFCVMCVLGLV-IVGD-VAYAQDSAEDYVNAHNAARAEVGSQSPRQTVIVPSLAWDDTVAAYAESYANQRKGDCQLIHSGG--EYGENIAMSTGELSGTDAVKMWVDEKSNYDYDSNSCVGGE-CLHYTQVVWANSVRLG 143          

HSP 2 Score: 46.2098 bits (108), Expect = 1.424e-50
Identity = 17/19 (89.47%), Postives = 18/19 (94.74%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            CDNGGTFITCNYDPPG +V
Sbjct:  149 CDNGGTFITCNYDPPGNFV 167          
BLAST of CD858816 vs. Soybean peptides
Match: Glyma15g06830.1|PACid:16297886 ()

HSP 1 Score: 166.007 bits (419), Expect = 1.678e-48
Identity = 89/140 (63.57%), Postives = 109/140 (77.86%), Query Frame = 1
Query:   37 SFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVG---------VSNIVWDNTVAAFAQNYANQRK-DCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            SF ++CVLGL+ IVG  VAYAQDS  DYVNAHNAAR++V          V ++ WD+TVAA+A++YANQRK DC LIHSGG  +YGENIAMSTG +SGTDAVK+WV+EK++YDYNSN+C  G+ C HYT VV  +S RLG
Sbjct:    9 SFCVMCVLGLV-IVGD-VAYAQDSAQDYVNAHNAARAEVSSQSPRANVIVPSLAWDDTVAAYAESYANQRKGDCALIHSGG--KYGENIAMSTGELSGTDAVKMWVDEKANYDYNSNSCVGGE-CLHYTQVVWAHSLRLG 143          

HSP 2 Score: 44.669 bits (104), Expect = 1.678e-48
Identity = 17/19 (89.47%), Postives = 17/19 (89.47%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            CDNGGTFITCNYDPPG  V
Sbjct:  149 CDNGGTFITCNYDPPGNLV 167          
BLAST of CD858816 vs. Soybean peptides
Match: Glyma15g06840.1|PACid:16297887 ()

HSP 1 Score: 141.354 bits (355), Expect = 2.672e-39
Identity = 69/104 (66.35%), Postives = 88/104 (84.62%), Query Frame = 1
Query:  118 YVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQRK-DCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            +V+AHNAARS+VGV ++ WD++VAA+A+NYANQRK DC LIHSGG   YGENIAMSTG +SGTDAVK+WV+EK++YD++SN+C  G+ C HYT VV  +S RLG
Sbjct:    5 HVDAHNAARSEVGVPDLAWDDSVAAYAENYANQRKGDCALIHSGG--EYGENIAMSTGELSGTDAVKMWVDEKANYDHDSNSCVGGE-CLHYTQVVWRDSVRLG 105          

HSP 2 Score: 38.5058 bits (88), Expect = 2.672e-39
Identity = 14/14 (100.00%), Postives = 14/14 (100.00%), Query Frame = 3
Query:  444 CDNGGTFITCNYDP 485
            CDNGGTFITCNYDP
Sbjct:  111 CDNGGTFITCNYDP 124          
BLAST of CD858816 vs. SwissProt
Match: PR1C_TOBAC (Pathogenesis-related protein 1C OS=Nicotiana tabacum PE=2 SV=3)

HSP 1 Score: 142.895 bits (359), Expect = 4.649e-38
Identity = 71/141 (50.35%), Postives = 102/141 (72.34%), Query Frame = 1
Query:   10 KLIVITKMSSFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQ-RKDCQLIHSGGGGRYGENIAMSTGG-MSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            + ++ ++MSSF ++  L L+F++ SH  +AQ+S  DY++AHN AR+ VGV  + WD+ VAA+AQNYA+Q   DC L+HS   G+YGEN+A  +G  ++   AV++WVNEK  Y ++SNTCA G+VCGHYT VV  NS R+G
Sbjct:    2 EFVLFSQMSSFFLVSTL-LLFLIISHSCHAQNSQQDYLDAHNTARADVGVEPLTWDDQVAAYAQNYASQLAADCNLVHS--HGQYGENLAWGSGDFLTAAKAVEMWVNEKQYYAHDSNTCAQGQVCGHYTQVVWRNSVRVG 139          

HSP 2 Score: 35.4242 bits (80), Expect = 4.649e-38
Identity = 11/19 (57.89%), Postives = 15/19 (78.95%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            C+NGG  ++CNYDPPG  +
Sbjct:  145 CNNGGYIVSCNYDPPGNVI 163          
BLAST of CD858816 vs. SwissProt
Match: PR1B_TOBAC (Pathogenesis-related protein 1B OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 7.890e-38
Identity = 71/138 (51.45%), Postives = 100/138 (72.46%), Query Frame = 1
Query:   19 VITKMSSFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQ-RKDCQLIHSGGGGRYGENIAMSTGG-MSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            + ++M SF ++  L L+F++ SH ++AQ+S  DY++AHN AR+ VGV  + WDN VAA+AQNY +Q   DC L+HS   G+YGEN+A  +G  M+   AV++WV+EK  YD++SNTCA G+VCGHYT VV  NS R+G
Sbjct:    5 LFSQMPSFFLVSTL-LLFLIISHSSHAQNSQQDYLDAHNTARADVGVEPLTWDNGVAAYAQNYVSQLAADCNLVHS--HGQYGENLAQGSGDFMTAAKAVEMWVDEKQYYDHDSNTCAQGQVCGHYTQVVWRNSVRVG 139          

HSP 2 Score: 35.039 bits (79), Expect = 7.890e-38
Identity = 11/19 (57.89%), Postives = 15/19 (78.95%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            C+NGG  ++CNYDPPG  +
Sbjct:  145 CNNGGYVVSCNYDPPGNVI 163          
BLAST of CD858816 vs. SwissProt
Match: PR1A_TOBAC (Pathogenesis-related protein 1A OS=Nicotiana tabacum PE=1 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 1.028e-37
Identity = 71/139 (51.08%), Postives = 100/139 (71.94%), Query Frame = 1
Query:   16 IVITKMSSFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQ-RKDCQLIHSGGGGRYGENIAMSTGG-MSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            ++ +++ SF ++  L L+F+V SH   AQ+S  DY++AHN AR+ VGV  + WD+ VAA+AQNYA+Q   DC L+HS   G+YGEN+A  +G  M+   AV++WV+EK  YD++SNTCA G+VCGHYT VV  NS R+G
Sbjct:    4 VLFSQLPSFLLVSTL-LLFLVISHSCRAQNSQQDYLDAHNTARADVGVEPLTWDDQVAAYAQNYASQLAADCNLVHS--HGQYGENLAEGSGDFMTAAKAVEMWVDEKQYYDHDSNTCAQGQVCGHYTQVVWRNSVRVG 139          

HSP 2 Score: 36.965 bits (84), Expect = 1.028e-37
Identity = 12/18 (66.67%), Postives = 15/18 (83.33%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTY 497
            C+NGG  ++CNYDPPG Y
Sbjct:  145 CNNGGYVVSCNYDPPGNY 162          
BLAST of CD858816 vs. SwissProt
Match: PR1_SAMNI (Pathogenesis-related protein PR-1 type OS=Sambucus nigra PE=2 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 1.028e-37
Identity = 70/132 (53.03%), Postives = 95/132 (71.97%), Query Frame = 1
Query:   37 SFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQRK-DCQLIHSGGGGRYGENIAMSTG-GMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            S +++CV+ L+ +     + AQ+SP DYV+AHNAARS V V  + WD +VAAFA+ YA  R  DC+L+HS G  RYGEN+A  +G  ++G +AV +WV E++DY+ N+NTCA GKVCGHYT VV  NS R+G
Sbjct:   11 SVALVCVVALVMV---QYSVAQNSPQDYVDAHNAARSAVNVGPVTWDESVAAFARQYAQSRAGDCRLVHS-GDPRYGENLAFGSGFELTGRNAVDMWVAERNDYNPNTNTCAPGKVCGHYTQVVWRNSVRIG 138          

HSP 2 Score: 36.965 bits (84), Expect = 1.028e-37
Identity = 13/18 (72.22%), Postives = 14/18 (77.78%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTY 497
            C+NG  FITCNY PPG Y
Sbjct:  144 CNNGAWFITCNYSPPGNY 161          
BLAST of CD858816 vs. SwissProt
Match: PRB1_TOBAC (Basic form of pathogenesis-related protein 1 OS=Nicotiana tabacum PE=3 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 4.161e-36
Identity = 70/122 (57.38%), Postives = 86/122 (70.49%), Query Frame = 1
Query:   64 LIFIVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQR-KDCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            + F +  H + AQ+SP DY+N HNAAR QVGV  + WDN +AA+AQNYANQR  DC +IHS   G YGEN+A +   ++   AVK+WV+EK  YDYNSN+C  G VCGHYT VV  NS RLG
Sbjct:   12 ITFAILIHSSKAQNSPQDYLNPHNAARRQVGVGPMTWDNRLAAYAQNYANQRIGDCGMIHS--HGPYGENLAAAFPQLNAAGAVKMWVDEKRFYDYNSNSCVGG-VCGHYTQVVWRNSVRLG 130          

HSP 2 Score: 34.6538 bits (78), Expect = 4.161e-36
Identity = 12/18 (66.67%), Postives = 15/18 (83.33%), Query Frame = 3
Query:  447 DNGGTFITCNYDPPGTYV 500
            +NG  FITCNYDPPG ++
Sbjct:  137 NNGWFFITCNYDPPGNFI 154          
BLAST of CD858816 vs. SwissProt
Match: PR1A_SOLLC (Pathogenesis-related protein 1A1 OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 9.200e-36
Identity = 69/132 (52.27%), Postives = 87/132 (65.91%), Query Frame = 1
Query:   34 SSFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQRKD-CQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            SS  + C +  I     H + AQ    +++NAHNAAR +VGV  + WD+ +AA+AQNYANQR D C +IHS G   YGEN+A +   ++   AVK+W +EK  YDYNSNTCA GKVCGHYT VV   S RLG
Sbjct:    3 SSIFVACFITFIIF---HSSQAQTPRENFLNAHNAARRRVGVGPMTWDDGLAAYAQNYANQRADDCGMIHSDGP--YGENLAAAFPQLNAAGAVKMWDDEKQWYDYNSNTCAPGKVCGHYTQVVWRKSVRLG 129          

HSP 2 Score: 38.5058 bits (88), Expect = 9.200e-36
Identity = 13/19 (68.42%), Postives = 16/19 (84.21%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            C++G  FITCNYDPPG Y+
Sbjct:  135 CNSGWVFITCNYDPPGNYI 153          
BLAST of CD858816 vs. SwissProt
Match: PR1_HORVU (Pathogenesis-related protein 1 OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 1.821e-33
Identity = 69/117 (58.97%), Postives = 81/117 (69.23%), Query Frame = 1
Query:   85 HVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQR-KDCQLIHSGGGGRYGENIAMSTGGMS--GTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            +++ AQ+SP DYV+ HNAARS VGV  + W   + AFAQNYANQR  DC+L HSGG   YGENI   + G     +DAV  WV+EK DYDY SNTCAAGKVCGHYT VV   S  +G
Sbjct:   20 NLSQAQNSPQDYVSPHNAARSAVGVGAVSWSTKLQAFAQNYANQRINDCKLQHSGGP--YGENIFWGSAGADWKASDAVNSWVSEKKDYDYGSNTCAAGKVCGHYTQVVWRASTSIG 134          

HSP 2 Score: 28.8758 bits (63), Expect = 1.821e-33
Identity = 10/18 (55.56%), Postives = 13/18 (72.22%), Query Frame = 3
Query:  447 DNGGTFITCNYDPPGTYV 500
            +N G FITCNY+P G  +
Sbjct:  142 NNRGVFITCNYEPRGNII 159          
BLAST of CD858816 vs. SwissProt
Match: PR12_HORVU (Pathogenesis-related protein PRB1-2 OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 1.821e-33
Identity = 69/117 (58.97%), Postives = 80/117 (68.38%), Query Frame = 1
Query:   85 HVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQR-KDCQLIHSGGGGRYGENIAMSTGGMS--GTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            +++ AQ+SP DYV+ HNAARS VGV  + W   + AFAQNYANQR  DC+L HSGG   YGENI   + G      DAV  WVNEK DY+Y SNTCAAGKVCGHYT VV   S  +G
Sbjct:   20 NLSQAQNSPQDYVSPHNAARSAVGVGAVSWSTKLQAFAQNYANQRINDCKLQHSGGP--YGENIFWGSAGADWKAADAVNSWVNEKKDYNYGSNTCAAGKVCGHYTQVVWRASTSIG 134          

HSP 2 Score: 29.261 bits (64), Expect = 1.821e-33
Identity = 11/18 (61.11%), Postives = 13/18 (72.22%), Query Frame = 3
Query:  447 DNGGTFITCNYDPPGTYV 500
            +N G FITCNY+P G  V
Sbjct:  142 NNRGVFITCNYEPRGNIV 159          
BLAST of CD858816 vs. SwissProt
Match: PR1_ARATH (Pathogenesis-related protein 1 OS=Arabidopsis thaliana GN=At2g14610 PE=1 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 2.373e-33
Identity = 65/123 (52.85%), Postives = 85/123 (69.11%), Query Frame = 1
Query:   67 IFIVGSHV--AYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQ-RKDCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            + +VG+ V  + AQDSP DY+  HN AR  VGV  + WD  VAA+A++YA Q R +C+LIHSGG   YGEN+A  +G +SG  AV +WV+EK++Y+Y +NTC    VCGHYT VV   S RLG
Sbjct:   14 VALVGALVLPSKAQDSPQDYLRVHNQARGAVGVGPMQWDERVAAYARSYAEQLRGNCRLIHSGGP--YGENLAWGSGDLSGVSAVNMWVSEKANYNYAANTC--NGVCGHYTQVVWRKSVRLG 132          

HSP 2 Score: 38.5058 bits (88), Expect = 2.373e-33
Identity = 14/19 (73.68%), Postives = 16/19 (84.21%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            C+NGGT I+CNYDP G YV
Sbjct:  138 CNNGGTIISCNYDPRGNYV 156          
BLAST of CD858816 vs. SwissProt
Match: PR13_HORVU (Pathogenesis-related protein PRB1-3 OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 3.089e-33
Identity = 68/117 (58.12%), Postives = 81/117 (69.23%), Query Frame = 1
Query:   85 HVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQR-KDCQLIHSGGGGRYGENIAMSTGGMS--GTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            +++ AQ+SP DYV+ HNAAR+ VGV  + W   + AFAQNYANQR  DC+L HSGG   YGENI   + G     +DAV  WV+EK DYDY SNTCAAGKVCGHYT VV   S  +G
Sbjct:   20 NLSQAQNSPQDYVSPHNAARAAVGVGAVSWSTKLQAFAQNYANQRINDCKLQHSGGP--YGENIFWGSAGADWKASDAVNSWVSEKKDYDYGSNTCAAGKVCGHYTQVVWRASTSIG 134          

HSP 2 Score: 29.261 bits (64), Expect = 3.089e-33
Identity = 11/18 (61.11%), Postives = 13/18 (72.22%), Query Frame = 3
Query:  447 DNGGTFITCNYDPPGTYV 500
            +N G FITCNY+P G  V
Sbjct:  142 NNRGVFITCNYEPRGNIV 159          
BLAST of CD858816 vs. Medicago proteins
Match: IMGA|Medtr4g050760.1 (Maturase K (Fragment) (AHRD V1 *-*- Q8MCK6_9FABA); contains Interpro domain(s) IPR014189 Quinone oxidoreductase putative, PIG3 chr04_pseudomolecule_IMGAG_V3.5 14970581-14991482 E EGN_Mt100125 20100825)

HSP 1 Score: 218.394 bits (555), Expect = 3.010e-63
Identity = 105/142 (73.94%), Postives = 124/142 (87.32%), Query Frame = 1
Query:    4 FQKLIVITKMSSFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQRK-DCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            F   +V+T+MSSFS+LC+L L+ ++G HVA AQ+S ADYVNAHN AR QVGV +IVWDNTVA+FAQ+YANQRK DCQLIHSGGGGRYGEN+A S+G MSG+DAVKLWVNEK+DY+YNSNTCA+GKVCGHYT VV  NS R+G
Sbjct:  322 FHIYMVVTEMSSFSLLCILALLLVIG-HVANAQNSRADYVNAHNDARRQVGVGDIVWDNTVASFAQDYANQRKGDCQLIHSGGGGRYGENLAWSSGDMSGSDAVKLWVNEKADYNYNSNTCASGKVCGHYTQVVWRNSQRVG 462          

HSP 2 Score: 40.817 bits (94), Expect = 3.010e-63
Identity = 17/20 (85.00%), Postives = 17/20 (85.00%), Query Frame = 3
Query:  444 CDNG-GTFITCNYDPPGTYV 500
            CDN  GTFITCNYDPPG YV
Sbjct:  468 CDNNRGTFITCNYDPPGNYV 487          
BLAST of CD858816 vs. Medicago proteins
Match: IMGA|Medtr2g010600.1 (Pathogenesis-related protein 1a (AHRD V1 ***- B5QTD3_BETVU); contains Interpro domain(s) IPR001283 Allergen V5/Tpx-1 related chr02_pseudomolecule_IMGAG_V3.5 2572060-2574224 E EGN_Mt100125 20100825)

HSP 1 Score: 214.927 bits (546), Expect = 3.328e-62
Identity = 105/133 (78.95%), Postives = 119/133 (89.47%), Query Frame = 1
Query:   31 MSSFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQRK-DCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            MSSFS+LCVLGL  I+  HVA+AQ+S +DYVNAHN AR QVGV+NIVWDNTVA+FAQ+YANQRK DCQLIHSGGGGRYGEN+A S+G MSG+DAVKLWVNEK+DYDYNSNTCA+GKVCGHYT VV  NS R+G
Sbjct:    1 MSSFSLLCVLGLSLIM-VHVAHAQNSQSDYVNAHNDARRQVGVANIVWDNTVASFAQDYANQRKGDCQLIHSGGGGRYGENLAWSSGDMSGSDAVKLWVNEKADYDYNSNTCASGKVCGHYTQVVWRNSQRVG 132          

HSP 2 Score: 40.817 bits (94), Expect = 3.328e-62
Identity = 17/20 (85.00%), Postives = 17/20 (85.00%), Query Frame = 3
Query:  444 CDNG-GTFITCNYDPPGTYV 500
            CDN  GTFITCNYDPPG YV
Sbjct:  138 CDNNRGTFITCNYDPPGNYV 157          
BLAST of CD858816 vs. Medicago proteins
Match: IMGA|Medtr2g012370.1 (Pathogenesis-related protein 1a (AHRD V1 ***- B5QTD3_BETVU); contains Interpro domain(s) IPR002413 Ves allergen chr02_pseudomolecule_IMGAG_V3.5 3251430-3250407 F EGN_Mt100125 20100825)

HSP 1 Score: 212.231 bits (539), Expect = 2.129e-61
Identity = 102/133 (76.69%), Postives = 118/133 (88.72%), Query Frame = 1
Query:   31 MSSFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQRK-DCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            MSSFS+LC+L L+ ++G HVA AQ+S ADYVNAHN AR QVGV +IVWDNTVA+FAQ+YANQRK DCQLIHSGGGGRYGEN+A S+G MSG+DAVKLWVNEK+DY+YNSNTCA+GKVCGHYT VV  NS R+G
Sbjct:    1 MSSFSLLCILALLLVIG-HVANAQNSRADYVNAHNDARRQVGVGDIVWDNTVASFAQDYANQRKGDCQLIHSGGGGRYGENLAWSSGDMSGSDAVKLWVNEKADYNYNSNTCASGKVCGHYTQVVWRNSQRVG 132          

HSP 2 Score: 40.817 bits (94), Expect = 2.129e-61
Identity = 17/20 (85.00%), Postives = 17/20 (85.00%), Query Frame = 3
Query:  444 CDNG-GTFITCNYDPPGTYV 500
            CDN  GTFITCNYDPPG YV
Sbjct:  138 CDNNRGTFITCNYDPPGNYV 157          
BLAST of CD858816 vs. Medicago proteins
Match: IMGA|Medtr2g012040.1 (Pathogenesis-related protein 1a (AHRD V1 ***- B5QTD3_BETVU); contains Interpro domain(s) IPR002413 Ves allergen chr02_pseudomolecule_IMGAG_V3.5 3103966-3102943 F EGN_Mt100125 20100825)

HSP 1 Score: 212.231 bits (539), Expect = 2.129e-61
Identity = 102/133 (76.69%), Postives = 118/133 (88.72%), Query Frame = 1
Query:   31 MSSFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQRK-DCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            MSSFS+LC+L L+ ++G HVA AQ+S ADYVNAHN AR QVGV +IVWDNTVA+FAQ+YANQRK DCQLIHSGGGGRYGEN+A S+G MSG+DAVKLWVNEK+DY+YNSNTCA+GKVCGHYT VV  NS R+G
Sbjct:    1 MSSFSLLCILALLLVIG-HVANAQNSRADYVNAHNDARRQVGVGDIVWDNTVASFAQDYANQRKGDCQLIHSGGGGRYGENLAWSSGDMSGSDAVKLWVNEKADYNYNSNTCASGKVCGHYTQVVWRNSQRVG 132          

HSP 2 Score: 40.817 bits (94), Expect = 2.129e-61
Identity = 17/20 (85.00%), Postives = 17/20 (85.00%), Query Frame = 3
Query:  444 CDNG-GTFITCNYDPPGTYV 500
            CDN  GTFITCNYDPPG YV
Sbjct:  138 CDNNRGTFITCNYDPPGNYV 157          
BLAST of CD858816 vs. Medicago proteins
Match: IMGA|Medtr2g010630.1 (Pathogenesis-related protein 1a (AHRD V1 ***- Q00MX6_MALDO); contains Interpro domain(s) IPR001283 Allergen V5/Tpx-1 related chr02_pseudomolecule_IMGAG_V3.5 2580943-2581440 E EGN_Mt100125 20100825)

HSP 1 Score: 203.371 bits (516), Expect = 3.945e-60
Identity = 98/136 (72.06%), Postives = 113/136 (83.09%), Query Frame = 1
Query:   31 MSSFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARS----QVGVSNIVWDNTVAAFAQNYANQRKDCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            M SFS+L +LGL  I+GSHVA+AQDSPADYVNAHN ARS     V + NIVWDN VAAFA+NYANQRKDCQL+HSGGGGRYGENIA STG MSG +AVKLWV+EK  YDY+SN+CA G++CGHYT VV  N+ R+G
Sbjct:    1 MGSFSLLFLLGLTLIMGSHVAHAQDSPADYVNAHNNARSAVHTNVKIPNIVWDNKVAAFAKNYANQRKDCQLVHSGGGGRYGENIAESTGNMSGVEAVKLWVDEKPYYDYSSNSCANGEMCGHYTQVVWRNTQRIG 136          

HSP 2 Score: 45.4394 bits (106), Expect = 3.945e-60
Identity = 16/19 (84.21%), Postives = 18/19 (94.74%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            C+NGGTFITCNYDPPG Y+
Sbjct:  142 CNNGGTFITCNYDPPGNYI 160          
BLAST of CD858816 vs. Medicago proteins
Match: IMGA|Medtr2g010590.1 (Pathogenesis-related protein 1a (AHRD V1 *-*- Q00MX6_MALDO); contains Interpro domain(s) IPR001283 Allergen V5/Tpx-1 related chr02_pseudomolecule_IMGAG_V3.5 2568981-2570759 H EGN_Mt100125 20100825)

HSP 1 Score: 195.667 bits (496), Expect = 2.967e-57
Identity = 94/133 (70.68%), Postives = 113/133 (84.96%), Query Frame = 1
Query:   31 MSSFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVGVSNIVWDNTVAAFAQNYANQRK-DCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            MSSFS++CVLGL  I+G HVA+AQ+S ADYVN+HN AR QVGV+N+VWDN +A  AQNYAN R+ DC+L HSGG  RYGEN+A STG +SGTDAV+LWVNEK+DY+YNSNTCA+GKVCGHYT VV  N+ R+G
Sbjct:    1 MSSFSLICVLGLFIIIG-HVAHAQNSQADYVNSHNEARRQVGVANVVWDNNLATVAQNYANSRRGDCRLTHSGG--RYGENLAGSTGDLSGTDAVRLWVNEKNDYNYNSNTCASGKVCGHYTQVVWRNTKRIG 130          

HSP 2 Score: 43.5134 bits (101), Expect = 2.967e-57
Identity = 16/19 (84.21%), Postives = 17/19 (89.47%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            C+NGGTFI CNYDPPG YV
Sbjct:  136 CNNGGTFIICNYDPPGNYV 154          
BLAST of CD858816 vs. Medicago proteins
Match: IMGA|Medtr2g010650.1 (Pathogenesis-related protein 1B (AHRD V1 ***- P07053); contains Interpro domain(s) IPR002413 Ves allergen chr02_pseudomolecule_IMGAG_V3.5 2585214-2585711 H EGN_Mt100125 20100825)

HSP 1 Score: 174.096 bits (440), Expect = 5.922e-52
Identity = 92/138 (66.67%), Postives = 110/138 (79.71%), Query Frame = 1
Query:   31 MSSFSIL-CVLGLIFIVG-SHVAYAQDSPADYVNAHNAARSQVG----VSNIVWDNTVAAFAQNYANQRKDCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            M SFS++ C+LGLI IV  SHVA+AQDSPADYVNAHN ARS V     + NI+WDN VAA+AQNYANQRKDCQL+HS GG RYGENIA S+G MSG +AVKL+V+EK +YDY+SN+C  G+ C HYT VV  N+ R+G
Sbjct:    1 MGSFSLIFCMLGLILIVHVSHVAHAQDSPADYVNAHNQARSAVDTNIKIPNIIWDNKVAAYAQNYANQRKDCQLVHS-GGDRYGENIAESSGDMSGIEAVKLFVDEKPNYDYSSNSCVGGE-CLHYTQVVWRNTKRIG 136          

HSP 2 Score: 47.3654 bits (111), Expect = 5.922e-52
Identity = 17/19 (89.47%), Postives = 18/19 (94.74%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPGTYV 500
            CDNGGTFITCNYDPPG Y+
Sbjct:  142 CDNGGTFITCNYDPPGNYI 160          
BLAST of CD858816 vs. Medicago proteins
Match: IMGA|Medtr2g010700.1 (Pathogenesis-related protein 1B (AHRD V1 ***- P07053); contains Interpro domain(s) IPR002413 Ves allergen chr02_pseudomolecule_IMGAG_V3.5 2597479-2597985 H EGN_Mt100125 20100825)

HSP 1 Score: 172.17 bits (435), Expect = 1.186e-49
Identity = 87/139 (62.59%), Postives = 105/139 (75.54%), Query Frame = 1
Query:   31 MSSFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVG---VSNIVWDNTVAAFAQNYANQRKDCQLIHSGGGGRY----GENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            M SFS LC+LGL  I+GSHVA+AQDSPADYVNAHN ARS +    + NIVWDN +AAFAQNYANQRKDC+ I SG GGRY    GENIA+STG +SG +AVKLWV+E+  +++ +N+C  G  C HYT VV   S R+G
Sbjct:    1 MGSFSQLCLLGLTLIMGSHVAHAQDSPADYVNAHNKARSAITTIKIPNIVWDNDIAAFAQNYANQRKDCKQIPSGSGGRYGEYLGENIAVSTGYISGAEAVKLWVDEEPYFNHYANSCIDGHECHHYTQVVWEKSLRVG 139          

HSP 2 Score: 41.5874 bits (96), Expect = 1.186e-49
Identity = 14/16 (87.50%), Postives = 16/16 (100.00%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPG 491
            CDNGG+F+TCNYDPPG
Sbjct:  145 CDNGGSFVTCNYDPPG 160          
BLAST of CD858816 vs. Medicago proteins
Match: IMGA|Medtr2g010640.1 (Pathogenesis-related protein 1B (AHRD V1 ***- P07053); contains Interpro domain(s) IPR001283 Allergen V5/Tpx-1 related chr02_pseudomolecule_IMGAG_V3.5 2581934-2582464 E EGN_Mt100125 20100825)

HSP 1 Score: 169.859 bits (429), Expect = 1.547e-49
Identity = 86/135 (63.70%), Postives = 101/135 (74.81%), Query Frame = 1
Query:   31 MSSFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAAR---SQVGVSNIVWDNTVAAFAQNYANQRKDCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            M S S+LCVLGLI IVGS VA +QDSPADYVNAHNAAR   +   + NIVWD  VAAFAQNYAN+RKDC+ I SG GGRYGENIA+STG  S  DAVK+WV E+  YD+ +N+C  G+ C HYT V+   S R+G
Sbjct:    1 MGSLSLLCVLGLILIVGSQVAISQDSPADYVNAHNAARFVITSAKIPNIVWDEKVAAFAQNYANKRKDCKQIPSGSGGRYGENIAVSTGYKSVRDAVKIWVEEEPHYDHYNNSCVGGE-CLHYTQVIWEKSQRVG 134          

HSP 2 Score: 43.5134 bits (101), Expect = 1.547e-49
Identity = 16/16 (100.00%), Postives = 16/16 (100.00%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPG 491
            CDNGGTFITCNYDPPG
Sbjct:  140 CDNGGTFITCNYDPPG 155          
BLAST of CD858816 vs. Medicago proteins
Match: IMGA|Medtr2g010670.1 (Pathogenesis-related protein 1A (AHRD V1 ***- P08299); contains Interpro domain(s) IPR002413 Ves allergen chr02_pseudomolecule_IMGAG_V3.5 2589806-2590316 E EGN_Mt100125 20100825)

HSP 1 Score: 167.548 bits (423), Expect = 4.031e-47
Identity = 89/136 (65.44%), Postives = 101/136 (74.26%), Query Frame = 1
Query:   31 MSSFSILCVLGLIFIVGSHVAYAQDSPADYVNAHNAARSQVG----VSNIVWDNTVAAFAQNYANQRKDCQLIHSGGGGRYGENIAMSTGGMSGTDAVKLWVNEKSDYDYNSNTCAAGKVCGHYTHVVRTNSARLG 426
            M SFS+  VLGLI IVGSHVA AQDSPADYVNAHN ARS V     + NIVWDN VAA+AQNYANQRKDC+ I S GGGRYG+NIA+STG +SGT AVK W +EK  +D   N C  G+ C H+T VV + S RLG
Sbjct:    1 MCSFSLWFVLGLIVIVGSHVAQAQDSPADYVNAHNKARSAVDSFIKIPNIVWDNEVAAYAQNYANQRKDCKPIPSNGGGRYGKNIAVSTGYISGTQAVKGWADEKPHFDNYLNKCFDGE-CHHFTQVVWSGSLRLG 135          

HSP 2 Score: 37.7354 bits (86), Expect = 4.031e-47
Identity = 13/16 (81.25%), Postives = 15/16 (93.75%), Query Frame = 3
Query:  444 CDNGGTFITCNYDPPG 491
            C+NGGTF+TCNY PPG
Sbjct:  141 CNNGGTFVTCNYYPPG 156          
The following BLAST results are available for this feature:
Homology Analysis: Pisum sativum unigene v1 vs Trembl
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
C6T1I7_SOYBN4.231e-5475.57Putative uncharacterized protein OS=Glycine max PE... [more]
C6T1N0_SOYBN1.089e-4865.71Putative uncharacterized protein OS=Glycine max PE... [more]
Q9XFB4_SOYBN4.449e-4764.29PR1a OS=Glycine max GN=PR1a PE=2 SV=1[more]
B9S7U9_RICCO2.849e-4664.12STS14 protein, putative OS=Ricinus communis GN=RCO... [more]
B5QTD3_BETVU1.972e-4465.55Pathogenesis-related protein 1a OS=Beta vulgaris G... [more]
Q00MX6_MALDO3.636e-4360.31Pathogenesis-related protein 1a OS=Malus domestica... [more]
A5BC26_VITVI4.739e-4358.65Putative uncharacterized protein OS=Vitis vinifera... [more]
A9PEI1_POPTR4.739e-4361.65Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
B9HN42_POPTR6.176e-4361.65Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
A5BNW5_VITVI6.177e-4359.85Putative uncharacterized protein OS=Vitis vinifera... [more]
back to top
Homology Analysis: Pisum sativum unigene v1 vs Swissprot
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Swissprot)
Total hits: 10
Match NameE-valueIdentityDescription
PR1C_TOBAC4.662e-3850.35Pathogenesis-related protein 1C OS=Nicotiana tabac... [more]
PR1B_TOBAC7.913e-3851.45Pathogenesis-related protein 1B OS=Nicotiana tabac... [more]
PR1A_TOBAC1.031e-3751.08Pathogenesis-related protein 1A OS=Nicotiana tabac... [more]
PR1_SAMNI1.031e-3753.03Pathogenesis-related protein PR-1 type OS=Sambucus... [more]
PRB1_TOBAC4.173e-3657.38Basic form of pathogenesis-related protein 1 OS=Ni... [more]
PR1A_SOLLC9.226e-3652.27Pathogenesis-related protein 1A1 OS=Solanum lycope... [more]
PR1_HORVU1.826e-3358.97Pathogenesis-related protein 1 OS=Hordeum vulgare ... [more]
PR12_HORVU1.826e-3358.97Pathogenesis-related protein PRB1-2 OS=Hordeum vul... [more]
PR1_ARATH2.380e-3352.85Pathogenesis-related protein 1 OS=Arabidopsis thal... [more]
PR13_HORVU3.097e-3358.12Pathogenesis-related protein PRB1-3 OS=Hordeum vul... [more]
back to top
Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide)
Total hits: 10
Match NameE-valueIdentityDescription
AT2G14580.11.781e-3955.88| Symbols: ATPRB1, PRB1 | basic pathogenesis-relat... [more]
AT4G33720.12.319e-3953.79| Symbols: | CAP (Cysteine-rich secretory protein... [more]
AT5G26130.13.264e-3853.91| Symbols: | CAP (Cysteine-rich secretory protein... [more]
AT4G33710.14.958e-3653.91| Symbols: | CAP (Cysteine-rich secretory protein... [more]
AT3G19690.14.962e-3650.38| Symbols: | CAP (Cysteine-rich secretory protein... [more]
AT2G14610.12.613e-3452.85| Symbols: PR1, PR 1, ATPR1 | pathogenesis-related... [more]
AT1G50060.12.508e-3150.78| Symbols: | CAP (Cysteine-rich secretory protein... [more]
AT1G50050.11.579e-3049.22| Symbols: | CAP (Cysteine-rich secretory protein... [more]
AT4G33730.11.622e-2647.86| Symbols: | CAP (Cysteine-rich secretory protein... [more]
AT2G19990.14.650e-2646.22| Symbols: PR-1-LIKE | pathogenesis-related protei... [more]
back to top
Homology Analysis: Pisum sativum unigene v2 vs TAIR 10 peptide
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs TAIR 10 peptide)
Total hits: 10
Match NameE-valueIdentityDescription
AT2G14580.11.781e-3955.88| Symbols: ATPRB1, PRB1 | basic pathogenesis-relat... [more]
AT4G33720.12.319e-3953.79| Symbols: | CAP (Cysteine-rich secretory protein... [more]
AT5G26130.13.264e-3853.91| Symbols: | CAP (Cysteine-rich secretory protein... [more]
AT4G33710.14.958e-3653.91| Symbols: | CAP (Cysteine-rich secretory protein... [more]
AT3G19690.14.962e-3650.38| Symbols: | CAP (Cysteine-rich secretory protein... [more]
AT2G14610.12.613e-3452.85| Symbols: PR1, PR 1, ATPR1 | pathogenesis-related... [more]
AT1G50060.12.508e-3150.78| Symbols: | CAP (Cysteine-rich secretory protein... [more]
AT1G50050.11.579e-3049.22| Symbols: | CAP (Cysteine-rich secretory protein... [more]
AT4G33730.11.622e-2647.86| Symbols: | CAP (Cysteine-rich secretory protein... [more]
AT2G19990.14.650e-2646.22| Symbols: PR-1-LIKE | pathogenesis-related protei... [more]
back to top
Homology Analysis: Pisum sativum unigene v2 vs Trembl
Analysis Date: 2011-04-27 (Homology Analysis: Pisum sativum unigene v2 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
C6T1I7_SOYBN5.291e-5475.57Putative uncharacterized protein OS=Glycine max PE... [more]
C6T1N0_SOYBN1.362e-4865.71Putative uncharacterized protein OS=Glycine max PE... [more]
Q9XFB4_SOYBN5.563e-4764.29PR1a OS=Glycine max GN=PR1a PE=2 SV=1[more]
B9S7U9_RICCO3.563e-4664.12STS14 protein, putative OS=Ricinus communis GN=RCO... [more]
B5QTD3_BETVU2.465e-4465.55Pathogenesis-related protein 1a OS=Beta vulgaris G... [more]
E2GEU0_9ROSI9.284e-4460.31Pathogenesis-related protein 1 OS=Vitis hybrid cul... [more]
E2GEV3_9ROSI1.210e-4361.24Pathogenesis-related protein 1 OS=Vitis hybrid cul... [more]
E2GEU3_9ROSI1.210e-4360.31Pathogenesis-related protein 1 OS=Vitis hybrid cul... [more]
E2GET9_9ROSI1.577e-4360.31Pathogenesis-related protein 1 OS=Vitis hybrid cul... [more]
Q00MX6_MALDO4.547e-4360.31Pathogenesis-related protein 1a OS=Malus domestica... [more]
back to top
Homology Analysis: Pisum sativum unigene v2 vs Lotus proteins
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Lotus proteins)
Total hits: 8
Match NameE-valueIdentityDescription
LjSGA_029184.13.838e-2947.54+ phase: 0 [more]
LjSGA_134572.14.135e-2841.54- phase: 0 [more]
LjSGA_032971.11.195e-2660.23- phase: 1 /pseudo/partial[more]
chr5.CM0696.210.r2.m2.236e-1736.84+ phase: 0 [more]
chr2.CM0323.230.r2.m5.759e-1332.59+ phase: 0 [more]
chr4.CM0165.120.r2.d4.918e-1231.48+ phase: 0 [more]
chr2.CM0323.250.r2.m3.277e-929.75+ phase: 0 /pseudo/partial[more]
chr2.CM0323.240.r2.m2.120e-725.53+ phase: 0 [more]
back to top
Homology Analysis: Pisum sativum unigene v2 vs Soybean peptides
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Soybean peptides)
Total hits: 10
Match NameE-valueIdentityDescription
Glyma15g06780.1|PACid:162978811.780e-6077.86[more]
Glyma15g06800.1|PACid:162978836.707e-6076.34[more]
Glyma15g06790.1|PACid:162978826.631e-5775.57[more]
Glyma13g32540.1|PACid:162923711.424e-5065.71[more]
Glyma13g32530.1|PACid:162923701.424e-5065.71[more]
Glyma13g32520.1|PACid:162923691.424e-5065.71[more]
Glyma13g32510.1|PACid:162923681.424e-5065.71[more]
Glyma13g32500.1|PACid:162923671.424e-5065.71[more]
Glyma15g06830.1|PACid:162978861.678e-4863.57[more]
Glyma15g06840.1|PACid:162978872.672e-3966.35[more]
back to top
Homology Analysis: Pisum sativum unigene v2 vs Swissprot
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Swissprot)
Total hits: 10
Match NameE-valueIdentityDescription
PR1C_TOBAC4.649e-3850.35Pathogenesis-related protein 1C OS=Nicotiana tabac... [more]
PR1B_TOBAC7.890e-3851.45Pathogenesis-related protein 1B OS=Nicotiana tabac... [more]
PR1A_TOBAC1.028e-3751.08Pathogenesis-related protein 1A OS=Nicotiana tabac... [more]
PR1_SAMNI1.028e-3753.03Pathogenesis-related protein PR-1 type OS=Sambucus... [more]
PRB1_TOBAC4.161e-3657.38Basic form of pathogenesis-related protein 1 OS=Ni... [more]
PR1A_SOLLC9.200e-3652.27Pathogenesis-related protein 1A1 OS=Solanum lycope... [more]
PR1_HORVU1.821e-3358.97Pathogenesis-related protein 1 OS=Hordeum vulgare ... [more]
PR12_HORVU1.821e-3358.97Pathogenesis-related protein PRB1-2 OS=Hordeum vul... [more]
PR1_ARATH2.373e-3352.85Pathogenesis-related protein 1 OS=Arabidopsis thal... [more]
PR13_HORVU3.089e-3358.12Pathogenesis-related protein PRB1-3 OS=Hordeum vul... [more]
back to top
Homology Analysis: Pisum sativum unigene v2 vs Medicago proteins
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Medicago proteins)
Total hits: 10
Match NameE-valueIdentityDescription
IMGA|Medtr4g050760.13.010e-6373.94Maturase K (Fragment) (AHRD V1 *-*- Q8MCK6_9FABA);... [more]
IMGA|Medtr2g010600.13.328e-6278.95Pathogenesis-related protein 1a (AHRD V1 ***- B5QT... [more]
IMGA|Medtr2g012370.12.129e-6176.69Pathogenesis-related protein 1a (AHRD V1 ***- B5QT... [more]
IMGA|Medtr2g012040.12.129e-6176.69Pathogenesis-related protein 1a (AHRD V1 ***- B5QT... [more]
IMGA|Medtr2g010630.13.945e-6072.06Pathogenesis-related protein 1a (AHRD V1 ***- Q00M... [more]
IMGA|Medtr2g010590.12.967e-5770.68Pathogenesis-related protein 1a (AHRD V1 *-*- Q00M... [more]
IMGA|Medtr2g010650.15.922e-5266.67Pathogenesis-related protein 1B (AHRD V1 ***- P070... [more]
IMGA|Medtr2g010700.11.186e-4962.59Pathogenesis-related protein 1B (AHRD V1 ***- P070... [more]
IMGA|Medtr2g010640.11.547e-4963.70Pathogenesis-related protein 1B (AHRD V1 ***- P070... [more]
IMGA|Medtr2g010670.14.031e-4765.44Pathogenesis-related protein 1A (AHRD V1 ***- P082... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v2
Date Performed: 2011-04-27
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001283Allergen V5/Tpx-1-relatedPRINTSPR00837V5TPXLIKEcoord: 56..74
score: 7.4e-10coord: 103..116
score: 7.4e-10coord: 127..143
score: 7.4
IPR001283Allergen V5/Tpx-1-relatedPANTHERPTHR10334CYSTEINE-RICH SECRETORY PROTEIN (CRISP/SCP/TPX1)-RELATEDcoord: 45..142
score: 2.8
IPR001283Allergen V5/Tpx-1-relatedSMARTSM00198no descriptioncoord: 35..152
score: 5.5
IPR002413Ves allergenPRINTSPR00838V5ALLERGENcoord: 56..74
score: 4.4e-05coord: 101..116
score: 4.4e-05coord: 126..145
score: 4.4
IPR014044CAP domainGENE3D3.40.33.10no descriptioncoord: 27..143
score: 4.1
IPR014044CAP domainPFAMPF00188CAPcoord: 41..143
score: 1
IPR014044CAP domainSUPERFAMILY55797PR-1-likecoord: 23..142
score: 3.1
NoneNo IPR availablePANTHERPTHR10334:SF7PATHOGENESIS-RELATED PROTEIN 1coord: 45..142
score: 2.8
NoneNo IPR availableSEGsegsegcoord: 14..25
score

Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSEGsegsegcoord: 14..25
score
NoneNo IPR availablePANTHERPTHR10334:SF7PATHOGENESIS-RELATED PROTEIN 1coord: 45..142
score: 2.8
IPR001283Allergen V5/Tpx-1-relatedPRINTSPR00837V5TPXLIKEcoord: 56..74
score: 7.4e-10coord: 103..116
score: 7.4e-10coord: 127..143
score: 7.4
IPR001283Allergen V5/Tpx-1-relatedPANTHERPTHR10334CYSTEINE-RICH SECRETORY PROTEIN (CRISP/SCP/TPX1)-RELATEDcoord: 45..142
score: 2.8
IPR001283Allergen V5/Tpx-1-relatedSMARTSM00198no descriptioncoord: 35..152
score: 5.5
IPR002413Ves allergenPRINTSPR00838V5ALLERGENcoord: 56..74
score: 4.4e-05coord: 101..116
score: 4.4e-05coord: 126..145
score: 4.4
IPR014044CAP domainGENE3D3.40.33.10no descriptioncoord: 27..143
score: 4.1
IPR014044CAP domainPFAMPF00188CAPcoord: 41..143
score: 1
IPR014044CAP domainSUPERFAMILY55797PR-1-likecoord: 23..142
score: 3.1

Properties
Property NameValue
Singlet in analysisPisum sativum unigene v2
Singlet in analysisPisum sativum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>CD858816 ID=CD858816|Name=CD858816|organism=Pisum sativum|type=EST|length=502bp
GCATTTCAGAAATTAATTGTAATAACTAAAATGAGTTCATTTTCTATACT
GTGTGTCTTGGGATTAATATTCATAGTGGGGAGTCACGTTGCATATGCAC
AAGACTCACCAGCAGATTACGTGAACGCCCACAACGCAGCAAGATCTCAG
GTTGGTGTTTCAAACATTGTTTGGGACAACACTGTGGCTGCTTTTGCACA
AAACTATGCTAATCAACGCAAGGATTGTCAACTGATCCACTCCGGCGGTG
GTGGCCGTTACGGGGAGAATATCGCGATGAGCACCGGTGGCATGAGCGGC
ACAGATGCAGTGAAGTTGTGGGTTAATGAGAAATCCGACTATGATTATAA
CAGTAATACATGTGCTGCTGGTAAAGTGTGTGGTCATTATACTCACGTTG
TTCGGACAAACTCAGCCCGTCTTGGCATGTGCCACACTGACCATGTGATA
ATGGAGGAACTTTCATTACATGCAACTATGATCCACCTGGCACCTATGTT
GC
back to top
Annotated Terms
The following terms have been associated with this EST:
Vocabulary: Cellular Component
TermDefinition
GO:0005576extracellular region
Vocabulary: INTERPRO
TermDefinition
IPR001283CRISP-related
IPR002413V5_allergen-like
IPR014044CAP_domain