AM161796
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of AM161796 vs. TrEMBL
Match: D7TRL2_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_191.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00003417001 PE=4 SV=1) HSP 1 Score: 58.5362 bits (140), Expect = 2.469e-7 Identity = 27/38 (71.05%), Postives = 30/38 (78.95%), Query Frame = 3 Query: 3 PHFRAELDKLCPLNVDQNKTGNLDATPVIFDNQLFLGL 116 P +R L+KLCPLNVDQN TG+LDATP IFDNQ F L Sbjct: 216 PKYRNRLNKLCPLNVDQNVTGDLDATPEIFDNQYFKDL 253
BLAST of AM161796 vs. TrEMBL
Match: C6T7D4_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 58.5362 bits (140), Expect = 2.469e-7 Identity = 24/38 (63.16%), Postives = 32/38 (84.21%), Query Frame = 3 Query: 3 PHFRAELDKLCPLNVDQNKTGNLDATPVIFDNQLFLGL 116 P +R EL+++CPL+VDQN TGNLD+TP++FDNQ F L Sbjct: 223 PSYRQELNRICPLDVDQNVTGNLDSTPLVFDNQYFKDL 260
BLAST of AM161796 vs. SwissProt
Match: PER17_ARATH (Peroxidase 17 OS=Arabidopsis thaliana GN=PER17 PE=2 SV=1) HSP 1 Score: 54.6842 bits (130), Expect = 1.751e-7 Identity = 24/38 (63.16%), Postives = 29/38 (76.32%), Query Frame = 3 Query: 3 PHFRAELDKLCPLNVDQNKTGNLDATPVIFDNQLFLGL 116 P +R +LDKLCPL D+N TG+LDATP +FDNQ F L Sbjct: 219 PSYRKKLDKLCPLGGDENVTGDLDATPQVFDNQYFKDL 256
BLAST of AM161796 vs. TAIR peptide
Match: AT2G22420.1 (| Symbols: | Peroxidase superfamily protein | chr2:9513341-9514484 FORWARD LENGTH=329) HSP 1 Score: 54.6842 bits (130), Expect = 1.392e-8 Identity = 24/38 (63.16%), Postives = 29/38 (76.32%), Query Frame = 3 Query: 3 PHFRAELDKLCPLNVDQNKTGNLDATPVIFDNQLFLGL 116 P +R +LDKLCPL D+N TG+LDATP +FDNQ F L Sbjct: 219 PSYRKKLDKLCPLGGDENVTGDLDATPQVFDNQYFKDL 256 The following BLAST results are available for this feature:
BLAST of AM161796 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl) Total hits: 2
BLAST of AM161796 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Swissprot) Total hits: 1
BLAST of AM161796 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide) Total hits: 1
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >AM161796 ID=AM161796; Name=AM161796; organism=Pisum sativum; type=EST; length=127bpback to top |