AA430918

EST Overview
NameAA430918
Unique NameAA430918
TypeEST
OrganismPisum sativum (pea)
Sequence length163
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
Pisum sativum unigene v12010-12-27
Homology Analysis: Pisum sativum unigene v1 vs Trembl2010-12-28
Homology Analysis: Pisum sativum unigene v1 vs Swissprot2010-12-28
InterProScan analysis for Pisum sativum unigene v12010-12-29
Libraries
Library NameType
LIBEST_000872 Whero seedling lambda ZapII cDNA librarycdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Pisum sativum unigene v1Pisum sativum unigene v1EST
Homology
BLAST of AA430918 vs. TrEMBL
Match: O24263_PEA (Pathogenesis-related protein PR10 (Fragment) OS=Pisum sativum var. pumilio GN=Ypr10.Pi.hum.2 PE=3 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 5.292e-18
Identity = 48/50 (96.00%), Postives = 49/50 (98.00%), Query Frame = 2
Query:    2 EAKLSAGPNGGSIAKLSVKYYTKGDAAAPTEEQLKSDKAKGDGLFKALEG 151
            EAKLSAGPNGGSIAKLSVKYYTKGD AAPTEEQLK+DKAKGDGLFKALEG
Sbjct:   54 EAKLSAGPNGGSIAKLSVKYYTKGD-AAPTEEQLKNDKAKGDGLFKALEG 102          
BLAST of AA430918 vs. TrEMBL
Match: O24256_9FABA (Pathogenesis-related protein PR10 OS=Pisum fulvum GN=Ypr10.Pi.ful.2 PE=3 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 5.292e-18
Identity = 48/50 (96.00%), Postives = 49/50 (98.00%), Query Frame = 2
Query:    2 EAKLSAGPNGGSIAKLSVKYYTKGDAAAPTEEQLKSDKAKGDGLFKALEG 151
            EAKLSAGPNGGSIAKLSVKYYTKGD AAPTEEQLK+DKAKGDGLFKALEG
Sbjct:  101 EAKLSAGPNGGSIAKLSVKYYTKGD-AAPTEEQLKTDKAKGDGLFKALEG 149          
BLAST of AA430918 vs. TrEMBL
Match: Q94IM3_MEDSA (Class 10 PR protein OS=Medicago sativa GN=pr10.2 PE=3 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 8.448e-16
Identity = 44/50 (88.00%), Postives = 47/50 (94.00%), Query Frame = 2
Query:    2 EAKLSAGPNGGSIAKLSVKYYTKGDAAAPTEEQLKSDKAKGDGLFKALEG 151
            EAKLSAGPNGGSIAKLSVKY+TKGD A P+EE+LKS KAKGDGLFKALEG
Sbjct:  101 EAKLSAGPNGGSIAKLSVKYFTKGD-ATPSEEELKSGKAKGDGLFKALEG 149          
BLAST of AA430918 vs. TrEMBL
Match: Q9SAT3_PEA (Root hair protein RH2 (Fragment) OS=Pisum sativum GN=rh2 PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 7.152e-15
Identity = 41/50 (82.00%), Postives = 47/50 (94.00%), Query Frame = 2
Query:    2 EAKLSAGPNGGSIAKLSVKYYTKGDAAAPTEEQLKSDKAKGDGLFKALEG 151
            EAKLSAGPNGGSIAKLSVKYYTKGD A P+EE++K+ KAKG+G+FKALEG
Sbjct:   98 EAKLSAGPNGGSIAKLSVKYYTKGD-AIPSEEEIKNGKAKGEGIFKALEG 146          
BLAST of AA430918 vs. TrEMBL
Match: O24253_PEA (Pathogenesis-related protein PR10 (Fragment) OS=Pisum sativum subsp. elatius GN=Ypr10.Pi.ela.3 PE=3 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 7.152e-15
Identity = 41/50 (82.00%), Postives = 47/50 (94.00%), Query Frame = 2
Query:    2 EAKLSAGPNGGSIAKLSVKYYTKGDAAAPTEEQLKSDKAKGDGLFKALEG 151
            EAKLSAGPNGGSIAKLSVKYYTKGD A P+EE++K+ KAKG+G+FKALEG
Sbjct:   54 EAKLSAGPNGGSIAKLSVKYYTKGD-AIPSEEEIKNGKAKGEGIFKALEG 102          
BLAST of AA430918 vs. TrEMBL
Match: Q7FNV7_MEDSA (Class 10 PR protein OS=Medicago sativa PE=3 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 6.055e-14
Identity = 39/50 (78.00%), Postives = 47/50 (94.00%), Query Frame = 2
Query:    2 EAKLSAGPNGGSIAKLSVKYYTKGDAAAPTEEQLKSDKAKGDGLFKALEG 151
            E+KLSAGP+GGSIAKL+VKY+TKGD AAP+EE++K  KA+GDGLFKALEG
Sbjct:  101 ESKLSAGPDGGSIAKLTVKYFTKGD-AAPSEEEIKGGKARGDGLFKALEG 149          
BLAST of AA430918 vs. TrEMBL
Match: P93333_MEDTR (PR10-1 protein OS=Medicago truncatula GN=PR10-1 PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 6.055e-14
Identity = 39/50 (78.00%), Postives = 47/50 (94.00%), Query Frame = 2
Query:    2 EAKLSAGPNGGSIAKLSVKYYTKGDAAAPTEEQLKSDKAKGDGLFKALEG 151
            E+KLSAGP+GGSIAKL+VKY+TKGD AAP+EE++K  KA+GDGLFKALEG
Sbjct:  101 ESKLSAGPDGGSIAKLTVKYFTKGD-AAPSEEEIKGGKARGDGLFKALEG 149          
BLAST of AA430918 vs. TrEMBL
Match: Q40320_MEDSA (Srg1 OS=Medicago sativa GN=SRG1 PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 2.301e-13
Identity = 38/50 (76.00%), Postives = 46/50 (92.00%), Query Frame = 2
Query:    2 EAKLSAGPNGGSIAKLSVKYYTKGDAAAPTEEQLKSDKAKGDGLFKALEG 151
            E+KLSAGP+GGS AKL+VKY+TKGD AAP+EE++K  KA+GDGLFKALEG
Sbjct:  101 ESKLSAGPDGGSTAKLTVKYFTKGD-AAPSEEEIKGGKARGDGLFKALEG 149          
BLAST of AA430918 vs. TrEMBL
Match: O24262_PEA (Pathogenesis-related protein PR10 (Fragment) OS=Pisum sativum var. pumilio GN=Ypr10.Pi.hum.1 PE=3 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 2.301e-13
Identity = 40/42 (95.24%), Postives = 41/42 (97.62%), Query Frame = 2
Query:    2 EAKLSAGPNGGSIAKLSVKYYTKGDAAAPTEEQLKSDKAKGD 127
            EAKLSAGPNGGSIAKLSVKYYTKGD AAPTEEQLK+DKAKGD
Sbjct:   54 EAKLSAGPNGGSIAKLSVKYYTKGD-AAPTEEQLKTDKAKGD 94          
BLAST of AA430918 vs. TrEMBL
Match: O24255_9FABA (Pathogenesis-related protein PR10 (Fragment) OS=Pisum fulvum GN=Ypr10.Pi.ful.1 PE=3 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 2.301e-13
Identity = 40/42 (95.24%), Postives = 41/42 (97.62%), Query Frame = 2
Query:    2 EAKLSAGPNGGSIAKLSVKYYTKGDAAAPTEEQLKSDKAKGD 127
            EAKLSAGPNGGSIAKLSVKYYTKGD AAPTEEQLK+DKAKGD
Sbjct:   54 EAKLSAGPNGGSIAKLSVKYYTKGD-AAPTEEQLKTDKAKGD 94          
BLAST of AA430918 vs. SwissProt
Match: DRR1_PEA (Disease resistance response protein Pi176 OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 8.111e-21
Identity = 49/49 (100.00%), Postives = 49/49 (100.00%), Query Frame = 2
Query:    2 EAKLSAGPNGGSIAKLSVKYYTKGDAAAPTEEQLKSDKAKGDGLFKALE 148
            EAKLSAGPNGGSIAKLSVKYYTKGDAAAPTEEQLKSDKAKGDGLFKALE
Sbjct:  101 EAKLSAGPNGGSIAKLSVKYYTKGDAAAPTEEQLKSDKAKGDGLFKALE 149          
BLAST of AA430918 vs. SwissProt
Match: DRR3_PEA (Disease resistance response protein Pi49 OS=Pisum sativum GN=DRR49A PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 2.209e-18
Identity = 46/50 (92.00%), Postives = 49/50 (98.00%), Query Frame = 2
Query:    2 EAKLSAGPNGGSIAKLSVKYYTKGDAAAPTEEQLKSDKAKGDGLFKALEG 151
            EAKLSAGPNGGSIAKLSVKY+TKGD AAP+EEQLK+DKAKGDGLFKALEG
Sbjct:  101 EAKLSAGPNGGSIAKLSVKYFTKGD-AAPSEEQLKTDKAKGDGLFKALEG 149          
BLAST of AA430918 vs. SwissProt
Match: DRR4_PEA (Disease resistance response protein DRRG49-C OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 3.526e-16
Identity = 41/50 (82.00%), Postives = 47/50 (94.00%), Query Frame = 2
Query:    2 EAKLSAGPNGGSIAKLSVKYYTKGDAAAPTEEQLKSDKAKGDGLFKALEG 151
            EAKLSAGPNGGSIAKLSVKYYTKGD A P+EE++K+ KAKG+G+FKALEG
Sbjct:  101 EAKLSAGPNGGSIAKLSVKYYTKGD-AIPSEEEIKNGKAKGEGIFKALEG 149          
BLAST of AA430918 vs. SwissProt
Match: PR1_MEDSA (Class-10 pathogenesis-related protein 1 OS=Medicago sativa GN=MSPR10-1 PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 1.134e-14
Identity = 38/50 (76.00%), Postives = 46/50 (92.00%), Query Frame = 2
Query:    2 EAKLSAGPNGGSIAKLSVKYYTKGDAAAPTEEQLKSDKAKGDGLFKALEG 151
            E+KLSAGP+GGS AKL+VKY+TKGD AAP+EE++K  KA+GDGLFKALEG
Sbjct:  101 ESKLSAGPDGGSTAKLTVKYFTKGD-AAPSEEEIKGGKARGDGLFKALEG 149          
BLAST of AA430918 vs. SwissProt
Match: PR2_PHAVU (Pathogenesis-related protein 2 OS=Phaseolus vulgaris PE=2 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 4.461e-11
Identity = 31/52 (59.62%), Postives = 41/52 (78.85%), Query Frame = 2
Query:    2 EAKLSAGPNGGSIAKLSVKYYTKGDAAAPTEEQLKSDKAKGDGLFKALEGLL 157
            ++KLS GPNGGS+ KLS+KY++KGD A P E++LK+ KAK D LFK +E  L
Sbjct:  101 DSKLSDGPNGGSVVKLSIKYHSKGD-APPNEDELKAGKAKSDALFKVIEAYL 151          
BLAST of AA430918 vs. SwissProt
Match: SAM22_SOYBN (Stress-induced protein SAM22 OS=Glycine max PE=1 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 1.695e-10
Identity = 32/52 (61.54%), Postives = 40/52 (76.92%), Query Frame = 2
Query:    2 EAKLSAGPNGGSIAKLSVKYYTKGDAAAPTEEQLKSDKAKGDGLFKALEGLL 157
            ++KL AGPNGGS  KL+VKY TKGD A P +++LK+ KAK D LFKA+E  L
Sbjct:  101 DSKLVAGPNGGSAGKLTVKYETKGD-AEPNQDELKTGKAKADALFKAIEAYL 151          
BLAST of AA430918 vs. SwissProt
Match: PR1_PHAVU (Pathogenesis-related protein 1 OS=Phaseolus vulgaris PE=1 SV=2)

HSP 1 Score: 64.6994 bits (156), Expect = 1.695e-10
Identity = 31/52 (59.62%), Postives = 41/52 (78.85%), Query Frame = 2
Query:    2 EAKLSAGPNGGSIAKLSVKYYTKGDAAAPTEEQLKSDKAKGDGLFKALEGLL 157
            ++KLS GPNGGS+ KLS+ Y++KGD A P E++LK+ KAK D LFKA+E  L
Sbjct:  102 DSKLSDGPNGGSLIKLSITYHSKGD-APPNEDELKAGKAKSDSLFKAVEAYL 152          
BLAST of AA430918 vs. SwissProt
Match: ABR18_PEA (ABA-responsive protein ABR18 OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 1.695e-10
Identity = 31/49 (63.27%), Postives = 39/49 (79.59%), Query Frame = 2
Query:    2 EAKLSAGPNGGSIAKLSVKYYTKGDAAAPTEEQLKSDKAKGDGLFKALE 148
            EAKL  GPNGGS+ K+ VKY+TKGD A P E++++  KAKGD LFKA+E
Sbjct:  101 EAKLFEGPNGGSVGKMIVKYHTKGD-AKPIEKEVEEGKAKGDALFKAIE 148          
BLAST of AA430918 vs. SwissProt
Match: L18B_LUPLU (Protein LlR18B OS=Lupinus luteus GN=LLR18B PE=1 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 2.992e-7
Identity = 26/50 (52.00%), Postives = 36/50 (72.00%), Query Frame = 2
Query:    2 EAKLSAGPNGGSIAKLSVKYYTKGDAAAPTEEQLKSDKAKGDGLFKALEG 151
            E+KL +GP+GGSI K+ VK++TKGD  +    +    KA+G GLFKA+EG
Sbjct:  101 ESKLLSGPDGGSIGKIKVKFHTKGDVLSDAVRE--EAKARGTGLFKAVEG 148          
BLAST of AA430918 vs. SwissProt
Match: ABR17_PEA (ABA-responsive protein ABR17 OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 52.7582 bits (125), Expect = 6.666e-7
Identity = 28/50 (56.00%), Postives = 35/50 (70.00%), Query Frame = 2
Query:    2 EAKLSAGPNGGSIAKLSVKYYTKGDAAAPTEEQLKSDKAKGDGLFKALEG 151
            E  + AG +GGSI K+SVKY+TKGDAA  ++      KAKG GL KA+EG
Sbjct:  101 ETIILAGSDGGSIVKISVKYHTKGDAAL-SDAVRDETKAKGTGLIKAIEG 149          
The following BLAST results are available for this feature:
BLAST of AA430918 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
O24263_PEA5.292e-1896.00Pathogenesis-related protein PR10 (Fragment) OS=Pi... [more]
O24256_9FABA5.292e-1896.00Pathogenesis-related protein PR10 OS=Pisum fulvum ... [more]
Q94IM3_MEDSA8.448e-1688.00Class 10 PR protein OS=Medicago sativa GN=pr10.2 P... [more]
Q9SAT3_PEA7.152e-1582.00Root hair protein RH2 (Fragment) OS=Pisum sativum ... [more]
O24253_PEA7.152e-1582.00Pathogenesis-related protein PR10 (Fragment) OS=Pi... [more]
Q7FNV7_MEDSA6.055e-1478.00Class 10 PR protein OS=Medicago sativa PE=3 SV=1[more]
P93333_MEDTR6.055e-1478.00PR10-1 protein OS=Medicago truncatula GN=PR10-1 PE... [more]
Q40320_MEDSA2.301e-1376.00Srg1 OS=Medicago sativa GN=SRG1 PE=2 SV=1[more]
O24262_PEA2.301e-1395.24Pathogenesis-related protein PR10 (Fragment) OS=Pi... [more]
O24255_9FABA2.301e-1395.24Pathogenesis-related protein PR10 (Fragment) OS=Pi... [more]
back to top
BLAST of AA430918 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Swissprot)
Total hits: 10
Match NameE-valueIdentityDescription
DRR1_PEA8.111e-21100.00Disease resistance response protein Pi176 OS=Pisum... [more]
DRR3_PEA2.209e-1892.00Disease resistance response protein Pi49 OS=Pisum ... [more]
DRR4_PEA3.526e-1682.00Disease resistance response protein DRRG49-C OS=Pi... [more]
PR1_MEDSA1.134e-1476.00Class-10 pathogenesis-related protein 1 OS=Medicag... [more]
PR2_PHAVU4.461e-1159.62Pathogenesis-related protein 2 OS=Phaseolus vulgar... [more]
SAM22_SOYBN1.695e-1061.54Stress-induced protein SAM22 OS=Glycine max PE=1 S... [more]
PR1_PHAVU1.695e-1059.62Pathogenesis-related protein 1 OS=Phaseolus vulgar... [more]
ABR18_PEA1.695e-1063.27ABA-responsive protein ABR18 OS=Pisum sativum PE=2... [more]
L18B_LUPLU2.992e-752.00Protein LlR18B OS=Lupinus luteus GN=LLR18B PE=1 SV... [more]
ABR17_PEA6.666e-756.00ABA-responsive protein ABR17 OS=Pisum sativum PE=2... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000916Bet v I allergenPRINTSPR00634BETALLERGENcoord: 9..25
score: 1.6e-07coord: 44..54
score: 1.6
IPR000916Bet v I allergenPFAMPF00407Bet_v_1coord: 6..50
score: 2.9
NoneNo IPR availableGENE3D3.30.530.20no descriptioncoord: 1..52
score: 2.4

Properties
Property NameValue
Singlet in analysisPisum sativum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>AA430918 ID=AA430918|Name=AA430918|organism=Pisum sativum|type=EST|length=163bp
GGAGGCTAAACTGTCTGCAGGACCAAATGGAGGATCCATTGCAAAGCTGA
GTGTGAAATATTACACAAAAGGTGATGCTGCTGCTCCTACTGAAGAGCAA
CTCAAGAGTGACAAAGCTAAGGGTGATGGTCTTTTCAAGGCTCTTGAGGG
GTTACTGTTTGGC
back to top
Annotated Terms
The following terms have been associated with this EST:
Vocabulary: Biological Process
TermDefinition
GO:0006952defense response
GO:0009607response to biotic stimulus
Vocabulary: INTERPRO
TermDefinition
IPR000916Bet_v_I/MLP