CD858744

EST Overview
NameCD858744
Unique NameCD858744
TypeEST
OrganismPisum sativum (pea)
Sequence length478
Libraries
Library NameType
LIBEST_013997 CIcdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Pisum sativum unigene v1Pisum sativum unigene v1EST
Homology
BLAST of CD858744 vs. TrEMBL
Match: B5AJV2_CUCMR (Ubiquitin carrier protein OS=Cucumis melo var. reticulatus PE=2 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 3.283e-63
Identity = 98/99 (98.99%), Postives = 99/99 (100.00%), Query Frame = -2
Query:   79 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYSGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 375
            MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYSGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALT+
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYSGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTV 99          

HSP 2 Score: 55.0694 bits (131), Expect = 3.283e-63
Identity = 25/31 (80.65%), Postives = 28/31 (90.32%), Query Frame = -1
Query:    2 PSVDHFQVLLSICSLLTDPNPDDPLVPEIAH 94
            P++   +VLLSICSLLTDPNPDDPLVPEIAH
Sbjct:   95 PALTVSKVLLSICSLLTDPNPDDPLVPEIAH 125          
BLAST of CD858744 vs. TrEMBL
Match: Q42897_SOLLC (Ubiquitin carrier protein OS=Solanum lycopersicum GN=UBC PE=2 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 5.581e-63
Identity = 98/99 (98.99%), Postives = 99/99 (100.00%), Query Frame = -2
Query:   79 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYSGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 375
            MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYSGGVFLV+IHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 99          

HSP 2 Score: 55.0694 bits (131), Expect = 5.581e-63
Identity = 25/31 (80.65%), Postives = 28/31 (90.32%), Query Frame = -1
Query:    2 PSVDHFQVLLSICSLLTDPNPDDPLVPEIAH 94
            P++   +VLLSICSLLTDPNPDDPLVPEIAH
Sbjct:   95 PALTISKVLLSICSLLTDPNPDDPLVPEIAH 125          
BLAST of CD858744 vs. TrEMBL
Match: Q38JG8_SOLTU (Ubiquitin carrier protein OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 5.581e-63
Identity = 98/99 (98.99%), Postives = 99/99 (100.00%), Query Frame = -2
Query:   79 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYSGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 375
            MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYSGGVFLV+IHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 99          

HSP 2 Score: 55.0694 bits (131), Expect = 5.581e-63
Identity = 25/31 (80.65%), Postives = 28/31 (90.32%), Query Frame = -1
Query:    2 PSVDHFQVLLSICSLLTDPNPDDPLVPEIAH 94
            P++   +VLLSICSLLTDPNPDDPLVPEIAH
Sbjct:   95 PALTISKVLLSICSLLTDPNPDDPLVPEIAH 125          
BLAST of CD858744 vs. TrEMBL
Match: Q06H23_ARAHY (Ubiquitin carrier protein OS=Arachis hypogaea PE=2 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 5.581e-63
Identity = 98/99 (98.99%), Postives = 99/99 (100.00%), Query Frame = -2
Query:   79 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYSGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 375
            MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPY+GGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYTGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 99          

HSP 2 Score: 55.0694 bits (131), Expect = 5.581e-63
Identity = 25/31 (80.65%), Postives = 28/31 (90.32%), Query Frame = -1
Query:    2 PSVDHFQVLLSICSLLTDPNPDDPLVPEIAH 94
            P++   +VLLSICSLLTDPNPDDPLVPEIAH
Sbjct:   95 PALTISKVLLSICSLLTDPNPDDPLVPEIAH 125          
BLAST of CD858744 vs. TrEMBL
Match: C6SW33_SOYBN (Ubiquitin carrier protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 5.581e-63
Identity = 98/99 (98.99%), Postives = 99/99 (100.00%), Query Frame = -2
Query:   79 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYSGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 375
            MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPY+GGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 99          

HSP 2 Score: 55.0694 bits (131), Expect = 5.581e-63
Identity = 25/31 (80.65%), Postives = 28/31 (90.32%), Query Frame = -1
Query:    2 PSVDHFQVLLSICSLLTDPNPDDPLVPEIAH 94
            P++   +VLLSICSLLTDPNPDDPLVPEIAH
Sbjct:   95 PALTISKVLLSICSLLTDPNPDDPLVPEIAH 125          
BLAST of CD858744 vs. TrEMBL
Match: B7FMV8_MEDTR (Ubiquitin carrier protein OS=Medicago truncatula PE=2 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 5.581e-63
Identity = 98/99 (98.99%), Postives = 99/99 (100.00%), Query Frame = -2
Query:   79 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYSGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 375
            MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPY+GGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 99          

HSP 2 Score: 55.0694 bits (131), Expect = 5.581e-63
Identity = 25/31 (80.65%), Postives = 28/31 (90.32%), Query Frame = -1
Query:    2 PSVDHFQVLLSICSLLTDPNPDDPLVPEIAH 94
            P++   +VLLSICSLLTDPNPDDPLVPEIAH
Sbjct:   95 PALTISKVLLSICSLLTDPNPDDPLVPEIAH 125          
BLAST of CD858744 vs. TrEMBL
Match: A9PHQ5_POPTR (Ubiquitin carrier protein OS=Populus trichocarpa GN=POPTRDRAFT_738992 PE=2 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 5.581e-63
Identity = 98/99 (98.99%), Postives = 99/99 (100.00%), Query Frame = -2
Query:   79 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYSGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 375
            MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPY+GGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 99          

HSP 2 Score: 55.0694 bits (131), Expect = 5.581e-63
Identity = 25/31 (80.65%), Postives = 28/31 (90.32%), Query Frame = -1
Query:    2 PSVDHFQVLLSICSLLTDPNPDDPLVPEIAH 94
            P++   +VLLSICSLLTDPNPDDPLVPEIAH
Sbjct:   95 PALTISKVLLSICSLLTDPNPDDPLVPEIAH 125          
BLAST of CD858744 vs. TrEMBL
Match: B9HDK6_POPTR (Ubiquitin carrier protein OS=Populus trichocarpa GN=POPTRDRAFT_561006 PE=3 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 1.228e-62
Identity = 97/99 (97.98%), Postives = 99/99 (100.00%), Query Frame = -2
Query:   79 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYSGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 375
            MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPY+GGVFLV+IHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI
Sbjct:   76 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 174          

HSP 2 Score: 55.0694 bits (131), Expect = 1.228e-62
Identity = 25/31 (80.65%), Postives = 28/31 (90.32%), Query Frame = -1
Query:    2 PSVDHFQVLLSICSLLTDPNPDDPLVPEIAH 94
            P++   +VLLSICSLLTDPNPDDPLVPEIAH
Sbjct:  170 PALTISKVLLSICSLLTDPNPDDPLVPEIAH 200          
BLAST of CD858744 vs. TrEMBL
Match: Q84YH4_GOSTH (Ubiquitin carrier protein OS=Gossypium thurberi PE=3 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 1.238e-62
Identity = 97/99 (97.98%), Postives = 99/99 (100.00%), Query Frame = -2
Query:   79 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYSGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 375
            MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGP+DSPY+GGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 99          

HSP 2 Score: 55.0694 bits (131), Expect = 1.238e-62
Identity = 25/31 (80.65%), Postives = 28/31 (90.32%), Query Frame = -1
Query:    2 PSVDHFQVLLSICSLLTDPNPDDPLVPEIAH 94
            P++   +VLLSICSLLTDPNPDDPLVPEIAH
Sbjct:   95 PALTISKVLLSICSLLTDPNPDDPLVPEIAH 125          
BLAST of CD858744 vs. TrEMBL
Match: Q84YH3_GOSRA (Ubiquitin carrier protein OS=Gossypium raimondii PE=3 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 1.238e-62
Identity = 97/99 (97.98%), Postives = 99/99 (100.00%), Query Frame = -2
Query:   79 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYSGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 375
            MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGP+DSPY+GGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 99          

HSP 2 Score: 55.0694 bits (131), Expect = 1.238e-62
Identity = 25/31 (80.65%), Postives = 28/31 (90.32%), Query Frame = -1
Query:    2 PSVDHFQVLLSICSLLTDPNPDDPLVPEIAH 94
            P++   +VLLSICSLLTDPNPDDPLVPEIAH
Sbjct:   95 PALTISKVLLSICSLLTDPNPDDPLVPEIAH 125          
BLAST of CD858744 vs. SwissProt
Match: UBC9_ARATH (SUMO-conjugating enzyme UBC9 OS=Arabidopsis thaliana GN=UBC9 PE=1 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 8.724e-64
Identity = 97/99 (97.98%), Postives = 99/99 (100.00%), Query Frame = -2
Query:   79 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYSGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 375
            MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGP+DSPYSGGVFLV+IHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 99          

HSP 2 Score: 55.0694 bits (131), Expect = 8.724e-64
Identity = 25/31 (80.65%), Postives = 28/31 (90.32%), Query Frame = -1
Query:    2 PSVDHFQVLLSICSLLTDPNPDDPLVPEIAH 94
            P++   +VLLSICSLLTDPNPDDPLVPEIAH
Sbjct:   95 PALTISKVLLSICSLLTDPNPDDPLVPEIAH 125          
BLAST of CD858744 vs. SwissProt
Match: UBC8_ARATH (Ubiquitin-conjugating enzyme E2 8 OS=Arabidopsis thaliana GN=UBC8 PE=1 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 1.138e-63
Identity = 97/99 (97.98%), Postives = 99/99 (100.00%), Query Frame = -2
Query:   79 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYSGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 375
            MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPA+SPYSGGVFLV+IHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPAESPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 99          

HSP 2 Score: 55.0694 bits (131), Expect = 1.138e-63
Identity = 25/31 (80.65%), Postives = 28/31 (90.32%), Query Frame = -1
Query:    2 PSVDHFQVLLSICSLLTDPNPDDPLVPEIAH 94
            P++   +VLLSICSLLTDPNPDDPLVPEIAH
Sbjct:   95 PALTISKVLLSICSLLTDPNPDDPLVPEIAH 125          
BLAST of CD858744 vs. SwissProt
Match: UBC4_SOLLC (Ubiquitin-conjugating enzyme E2-17 kDa OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 1.138e-63
Identity = 97/99 (97.98%), Postives = 98/99 (98.99%), Query Frame = -2
Query:   79 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYSGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 375
            MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGP DSPY+GGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPTDSPYAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 99          

HSP 2 Score: 55.0694 bits (131), Expect = 1.138e-63
Identity = 25/31 (80.65%), Postives = 28/31 (90.32%), Query Frame = -1
Query:    2 PSVDHFQVLLSICSLLTDPNPDDPLVPEIAH 94
            P++   +VLLSICSLLTDPNPDDPLVPEIAH
Sbjct:   95 PALTISKVLLSICSLLTDPNPDDPLVPEIAH 125          
BLAST of CD858744 vs. SwissProt
Match: UBC28_ARATH (Ubiquitin-conjugating enzyme E2 28 OS=Arabidopsis thaliana GN=UBC28 PE=2 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 1.138e-63
Identity = 96/99 (96.97%), Postives = 99/99 (100.00%), Query Frame = -2
Query:   79 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYSGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 375
            MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGP+DSPYSGGVFLV+IHFPPDYPFKPPKVAFRTKVFHPN+NSNGSICLDILKEQWSPALTI
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNVNSNGSICLDILKEQWSPALTI 99          

HSP 2 Score: 55.0694 bits (131), Expect = 1.138e-63
Identity = 25/31 (80.65%), Postives = 28/31 (90.32%), Query Frame = -1
Query:    2 PSVDHFQVLLSICSLLTDPNPDDPLVPEIAH 94
            P++   +VLLSICSLLTDPNPDDPLVPEIAH
Sbjct:   95 PALTISKVLLSICSLLTDPNPDDPLVPEIAH 125          
BLAST of CD858744 vs. SwissProt
Match: UBC10_ARATH (Ubiquitin-conjugating enzyme E2 10 OS=Arabidopsis thaliana GN=UBC10 PE=1 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 5.591e-63
Identity = 95/99 (95.96%), Postives = 99/99 (100.00%), Query Frame = -2
Query:   79 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYSGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 375
            MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGP++SPY+GGVFLV+IHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSESPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 99          

HSP 2 Score: 55.0694 bits (131), Expect = 5.591e-63
Identity = 25/31 (80.65%), Postives = 28/31 (90.32%), Query Frame = -1
Query:    2 PSVDHFQVLLSICSLLTDPNPDDPLVPEIAH 94
            P++   +VLLSICSLLTDPNPDDPLVPEIAH
Sbjct:   95 PALTISKVLLSICSLLTDPNPDDPLVPEIAH 125          
BLAST of CD858744 vs. SwissProt
Match: UBC11_ARATH (Ubiquitin-conjugating enzyme E2 11 OS=Arabidopsis thaliana GN=UBC11 PE=2 SV=2)

HSP 1 Score: 200.675 bits (509), Expect = 2.994e-61
Identity = 91/99 (91.92%), Postives = 98/99 (98.99%), Query Frame = -2
Query:   79 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYSGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 375
            MASKRILKELKDLQKDPP++CSAGPVAEDMFHWQATIMGP +SPY+GGVFLVSIHFPPDYPFKPPKV+F+TKV+HPNINSNGSICLDILKEQWSPALTI
Sbjct:    1 MASKRILKELKDLQKDPPSNCSAGPVAEDMFHWQATIMGPPESPYAGGVFLVSIHFPPDYPFKPPKVSFKTKVYHPNINSNGSICLDILKEQWSPALTI 99          

HSP 2 Score: 55.0694 bits (131), Expect = 2.994e-61
Identity = 25/31 (80.65%), Postives = 28/31 (90.32%), Query Frame = -1
Query:    2 PSVDHFQVLLSICSLLTDPNPDDPLVPEIAH 94
            P++   +VLLSICSLLTDPNPDDPLVPEIAH
Sbjct:   95 PALTISKVLLSICSLLTDPNPDDPLVPEIAH 125          
BLAST of CD858744 vs. SwissProt
Match: UBC29_ARATH (Ubiquitin-conjugating enzyme E2 29 OS=Arabidopsis thaliana GN=UBC29 PE=2 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 7.869e-59
Identity = 86/99 (86.87%), Postives = 94/99 (94.95%), Query Frame = -2
Query:   79 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYSGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 375
            MA++RILKELK+LQ+DPP SCSAGP  EDMFHWQATIMGP +SPYSGGVFLV+IHFPPDYPFKPPKV FRTKVFHPNINSNG+ICLDILK+QWSPALTI
Sbjct:    1 MATRRILKELKELQRDPPVSCSAGPTGEDMFHWQATIMGPNESPYSGGVFLVNIHFPPDYPFKPPKVVFRTKVFHPNINSNGNICLDILKDQWSPALTI 99          

HSP 2 Score: 55.0694 bits (131), Expect = 7.869e-59
Identity = 25/31 (80.65%), Postives = 28/31 (90.32%), Query Frame = -1
Query:    2 PSVDHFQVLLSICSLLTDPNPDDPLVPEIAH 94
            P++   +VLLSICSLLTDPNPDDPLVPEIAH
Sbjct:   95 PALTISKVLLSICSLLTDPNPDDPLVPEIAH 125          
BLAST of CD858744 vs. SwissProt
Match: UBC30_ARATH (Ubiquitin-conjugating enzyme E2 30 OS=Arabidopsis thaliana GN=UBC30 PE=2 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 1.338e-58
Identity = 86/99 (86.87%), Postives = 94/99 (94.95%), Query Frame = -2
Query:   79 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYSGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 375
            MASKRI KEL+DLQ+DPP SCSAGP  +DMF WQATIMGPADSP++GGVFLV+IHFPPDYPFKPPKVAFRTKV+HPNINSNGSICLDILKEQWSPALT+
Sbjct:    1 MASKRINKELRDLQRDPPVSCSAGPTGDDMFQWQATIMGPADSPFAGGVFLVTIHFPPDYPFKPPKVAFRTKVYHPNINSNGSICLDILKEQWSPALTV 99          

HSP 2 Score: 55.0694 bits (131), Expect = 1.338e-58
Identity = 25/31 (80.65%), Postives = 28/31 (90.32%), Query Frame = -1
Query:    2 PSVDHFQVLLSICSLLTDPNPDDPLVPEIAH 94
            P++   +VLLSICSLLTDPNPDDPLVPEIAH
Sbjct:   95 PALTVSKVLLSICSLLTDPNPDDPLVPEIAH 125          
BLAST of CD858744 vs. SwissProt
Match: UBC4_SCHPO (Ubiquitin-conjugating enzyme E2 4 OS=Schizosaccharomyces pombe GN=ubc4 PE=2 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 1.438e-54
Identity = 79/99 (79.80%), Postives = 90/99 (90.91%), Query Frame = -2
Query:   79 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYSGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 375
            MA KRI +EL DL KDPP+SCSAGPV +D+FHWQATIMGPADSPY+GGVF +SIHFP DYPFKPPKV F T+++HPNINSNGSICLDIL++QWSPALTI
Sbjct:    1 MALKRINRELADLGKDPPSSCSAGPVGDDLFHWQATIMGPADSPYAGGVFFLSIHFPTDYPFKPPKVNFTTRIYHPNINSNGSICLDILRDQWSPALTI 99          

HSP 2 Score: 55.0694 bits (131), Expect = 1.438e-54
Identity = 25/31 (80.65%), Postives = 28/31 (90.32%), Query Frame = -1
Query:    2 PSVDHFQVLLSICSLLTDPNPDDPLVPEIAH 94
            P++   +VLLSICSLLTDPNPDDPLVPEIAH
Sbjct:   95 PALTISKVLLSICSLLTDPNPDDPLVPEIAH 125          
BLAST of CD858744 vs. SwissProt
Match: UBC1_MAGGR (Ubiquitin-conjugating enzyme E2-16 kDa OS=Magnaporthe grisea GN=UBC1 PE=3 SV=2)

HSP 1 Score: 177.178 bits (448), Expect = 5.416e-54
Identity = 78/99 (78.79%), Postives = 90/99 (90.91%), Query Frame = -2
Query:   79 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYSGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 375
            MA KRI KEL DL +DPP+SCSAGPV ED+FHWQATIMGP+DSPY+GGVF ++IHFP DYPFKPPKV F T+++HPNINSNGSICLDIL++QWSPALTI
Sbjct:    1 MALKRINKELTDLGRDPPSSCSAGPVGEDLFHWQATIMGPSDSPYAGGVFFLAIHFPTDYPFKPPKVNFTTRIYHPNINSNGSICLDILRDQWSPALTI 99          

HSP 2 Score: 54.299 bits (129), Expect = 5.416e-54
Identity = 24/31 (77.42%), Postives = 28/31 (90.32%), Query Frame = -1
Query:    2 PSVDHFQVLLSICSLLTDPNPDDPLVPEIAH 94
            P++   +VLLSICS+LTDPNPDDPLVPEIAH
Sbjct:   95 PALTISKVLLSICSMLTDPNPDDPLVPEIAH 125          
BLAST of CD858744 vs. TAIR peptide
Match: AT4G27960.2 (| Symbols: UBC9 | ubiquitin conjugating enzyme 9 | chr4:13916065-13917293 REVERSE LENGTH=178)

HSP 1 Score: 209.149 bits (531), Expect = 1.005e-64
Identity = 97/99 (97.98%), Postives = 99/99 (100.00%), Query Frame = -2
Query:   79 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYSGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 375
            MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGP+DSPYSGGVFLV+IHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI
Sbjct:   31 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 129          

HSP 2 Score: 55.0694 bits (131), Expect = 1.005e-64
Identity = 25/31 (80.65%), Postives = 28/31 (90.32%), Query Frame = -1
Query:    2 PSVDHFQVLLSICSLLTDPNPDDPLVPEIAH 94
            P++   +VLLSICSLLTDPNPDDPLVPEIAH
Sbjct:  125 PALTISKVLLSICSLLTDPNPDDPLVPEIAH 155          
BLAST of CD858744 vs. TAIR peptide
Match: AT4G27960.1 (| Symbols: UBC9 | ubiquitin conjugating enzyme 9 | chr4:13916065-13917203 REVERSE LENGTH=148)

HSP 1 Score: 209.149 bits (531), Expect = 1.008e-64
Identity = 97/99 (97.98%), Postives = 99/99 (100.00%), Query Frame = -2
Query:   79 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYSGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 375
            MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGP+DSPYSGGVFLV+IHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 99          

HSP 2 Score: 55.0694 bits (131), Expect = 1.008e-64
Identity = 25/31 (80.65%), Postives = 28/31 (90.32%), Query Frame = -1
Query:    2 PSVDHFQVLLSICSLLTDPNPDDPLVPEIAH 94
            P++   +VLLSICSLLTDPNPDDPLVPEIAH
Sbjct:   95 PALTISKVLLSICSLLTDPNPDDPLVPEIAH 125          
BLAST of CD858744 vs. TAIR peptide
Match: AT5G41700.5 (| Symbols: UBC8 | ubiquitin conjugating enzyme 8 | chr5:16676072-16677223 FORWARD LENGTH=148)

HSP 1 Score: 208.764 bits (530), Expect = 1.314e-64
Identity = 97/99 (97.98%), Postives = 99/99 (100.00%), Query Frame = -2
Query:   79 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYSGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 375
            MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPA+SPYSGGVFLV+IHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPAESPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 99          

HSP 2 Score: 55.0694 bits (131), Expect = 1.314e-64
Identity = 25/31 (80.65%), Postives = 28/31 (90.32%), Query Frame = -1
Query:    2 PSVDHFQVLLSICSLLTDPNPDDPLVPEIAH 94
            P++   +VLLSICSLLTDPNPDDPLVPEIAH
Sbjct:   95 PALTISKVLLSICSLLTDPNPDDPLVPEIAH 125          
BLAST of CD858744 vs. TAIR peptide
Match: AT5G41700.1 (| Symbols: UBC8, ATUBC8 | ubiquitin conjugating enzyme 8 | chr5:16676072-16677223 FORWARD LENGTH=148)

HSP 1 Score: 208.764 bits (530), Expect = 1.314e-64
Identity = 97/99 (97.98%), Postives = 99/99 (100.00%), Query Frame = -2
Query:   79 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYSGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 375
            MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPA+SPYSGGVFLV+IHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPAESPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 99          

HSP 2 Score: 55.0694 bits (131), Expect = 1.314e-64
Identity = 25/31 (80.65%), Postives = 28/31 (90.32%), Query Frame = -1
Query:    2 PSVDHFQVLLSICSLLTDPNPDDPLVPEIAH 94
            P++   +VLLSICSLLTDPNPDDPLVPEIAH
Sbjct:   95 PALTISKVLLSICSLLTDPNPDDPLVPEIAH 125          
BLAST of CD858744 vs. TAIR peptide
Match: AT5G41700.2 (| Symbols: UBC8, ATUBC8 | ubiquitin conjugating enzyme 8 | chr5:16676072-16677223 FORWARD LENGTH=148)

HSP 1 Score: 208.764 bits (530), Expect = 1.314e-64
Identity = 97/99 (97.98%), Postives = 99/99 (100.00%), Query Frame = -2
Query:   79 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYSGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 375
            MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPA+SPYSGGVFLV+IHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPAESPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 99          

HSP 2 Score: 55.0694 bits (131), Expect = 1.314e-64
Identity = 25/31 (80.65%), Postives = 28/31 (90.32%), Query Frame = -1
Query:    2 PSVDHFQVLLSICSLLTDPNPDDPLVPEIAH 94
            P++   +VLLSICSLLTDPNPDDPLVPEIAH
Sbjct:   95 PALTISKVLLSICSLLTDPNPDDPLVPEIAH 125          
BLAST of CD858744 vs. TAIR peptide
Match: AT1G64230.2 (| Symbols: UBC28 | ubiquitin-conjugating enzyme 28 | chr1:23833792-23835220 FORWARD LENGTH=148)

HSP 1 Score: 208.764 bits (530), Expect = 1.314e-64
Identity = 96/99 (96.97%), Postives = 99/99 (100.00%), Query Frame = -2
Query:   79 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYSGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 375
            MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGP+DSPYSGGVFLV+IHFPPDYPFKPPKVAFRTKVFHPN+NSNGSICLDILKEQWSPALTI
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNVNSNGSICLDILKEQWSPALTI 99          

HSP 2 Score: 55.0694 bits (131), Expect = 1.314e-64
Identity = 25/31 (80.65%), Postives = 28/31 (90.32%), Query Frame = -1
Query:    2 PSVDHFQVLLSICSLLTDPNPDDPLVPEIAH 94
            P++   +VLLSICSLLTDPNPDDPLVPEIAH
Sbjct:   95 PALTISKVLLSICSLLTDPNPDDPLVPEIAH 125          
BLAST of CD858744 vs. TAIR peptide
Match: AT1G64230.1 (| Symbols: UBC28 | ubiquitin-conjugating enzyme 28 | chr1:23833792-23835220 FORWARD LENGTH=148)

HSP 1 Score: 208.764 bits (530), Expect = 1.314e-64
Identity = 96/99 (96.97%), Postives = 99/99 (100.00%), Query Frame = -2
Query:   79 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYSGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 375
            MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGP+DSPYSGGVFLV+IHFPPDYPFKPPKVAFRTKVFHPN+NSNGSICLDILKEQWSPALTI
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNVNSNGSICLDILKEQWSPALTI 99          

HSP 2 Score: 55.0694 bits (131), Expect = 1.314e-64
Identity = 25/31 (80.65%), Postives = 28/31 (90.32%), Query Frame = -1
Query:    2 PSVDHFQVLLSICSLLTDPNPDDPLVPEIAH 94
            P++   +VLLSICSLLTDPNPDDPLVPEIAH
Sbjct:   95 PALTISKVLLSICSLLTDPNPDDPLVPEIAH 125          
BLAST of CD858744 vs. TAIR peptide
Match: AT5G53300.4 (| Symbols: UBC10 | ubiquitin-conjugating enzyme 10 | chr5:21632802-21633989 REVERSE LENGTH=148)

HSP 1 Score: 206.453 bits (524), Expect = 6.460e-64
Identity = 95/99 (95.96%), Postives = 99/99 (100.00%), Query Frame = -2
Query:   79 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYSGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 375
            MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGP++SPY+GGVFLV+IHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSESPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 99          

HSP 2 Score: 55.0694 bits (131), Expect = 6.460e-64
Identity = 25/31 (80.65%), Postives = 28/31 (90.32%), Query Frame = -1
Query:    2 PSVDHFQVLLSICSLLTDPNPDDPLVPEIAH 94
            P++   +VLLSICSLLTDPNPDDPLVPEIAH
Sbjct:   95 PALTISKVLLSICSLLTDPNPDDPLVPEIAH 125          
BLAST of CD858744 vs. TAIR peptide
Match: AT5G53300.2 (| Symbols: UBC10 | ubiquitin-conjugating enzyme 10 | chr5:21632802-21633989 REVERSE LENGTH=148)

HSP 1 Score: 206.453 bits (524), Expect = 6.460e-64
Identity = 95/99 (95.96%), Postives = 99/99 (100.00%), Query Frame = -2
Query:   79 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYSGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 375
            MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGP++SPY+GGVFLV+IHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSESPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 99          

HSP 2 Score: 55.0694 bits (131), Expect = 6.460e-64
Identity = 25/31 (80.65%), Postives = 28/31 (90.32%), Query Frame = -1
Query:    2 PSVDHFQVLLSICSLLTDPNPDDPLVPEIAH 94
            P++   +VLLSICSLLTDPNPDDPLVPEIAH
Sbjct:   95 PALTISKVLLSICSLLTDPNPDDPLVPEIAH 125          
BLAST of CD858744 vs. TAIR peptide
Match: AT5G53300.1 (| Symbols: UBC10 | ubiquitin-conjugating enzyme 10 | chr5:21632802-21633989 REVERSE LENGTH=148)

HSP 1 Score: 206.453 bits (524), Expect = 6.460e-64
Identity = 95/99 (95.96%), Postives = 99/99 (100.00%), Query Frame = -2
Query:   79 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYSGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 375
            MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGP++SPY+GGVFLV+IHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSESPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 99          

HSP 2 Score: 55.0694 bits (131), Expect = 6.460e-64
Identity = 25/31 (80.65%), Postives = 28/31 (90.32%), Query Frame = -1
Query:    2 PSVDHFQVLLSICSLLTDPNPDDPLVPEIAH 94
            P++   +VLLSICSLLTDPNPDDPLVPEIAH
Sbjct:   95 PALTISKVLLSICSLLTDPNPDDPLVPEIAH 125          
The following BLAST results are available for this feature:
Homology Analysis: Pisum sativum unigene v1 vs Trembl
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
B5AJV2_CUCMR3.283e-6398.99Ubiquitin carrier protein OS=Cucumis melo var. ret... [more]
Q42897_SOLLC5.581e-6398.99Ubiquitin carrier protein OS=Solanum lycopersicum ... [more]
Q38JG8_SOLTU5.581e-6398.99Ubiquitin carrier protein OS=Solanum tuberosum PE=... [more]
Q06H23_ARAHY5.581e-6398.99Ubiquitin carrier protein OS=Arachis hypogaea PE=2... [more]
C6SW33_SOYBN5.581e-6398.99Ubiquitin carrier protein OS=Glycine max PE=2 SV=1[more]
B7FMV8_MEDTR5.581e-6398.99Ubiquitin carrier protein OS=Medicago truncatula P... [more]
A9PHQ5_POPTR5.581e-6398.99Ubiquitin carrier protein OS=Populus trichocarpa G... [more]
B9HDK6_POPTR1.228e-6297.98Ubiquitin carrier protein OS=Populus trichocarpa G... [more]
Q84YH4_GOSTH1.238e-6297.98Ubiquitin carrier protein OS=Gossypium thurberi PE... [more]
Q84YH3_GOSRA1.238e-6297.98Ubiquitin carrier protein OS=Gossypium raimondii P... [more]
back to top
Homology Analysis: Pisum sativum unigene v1 vs Swissprot
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Swissprot)
Total hits: 10
Match NameE-valueIdentityDescription
UBC9_ARATH8.724e-6497.98SUMO-conjugating enzyme UBC9 OS=Arabidopsis thalia... [more]
UBC8_ARATH1.138e-6397.98Ubiquitin-conjugating enzyme E2 8 OS=Arabidopsis t... [more]
UBC4_SOLLC1.138e-6397.98Ubiquitin-conjugating enzyme E2-17 kDa OS=Solanum ... [more]
UBC28_ARATH1.138e-6396.97Ubiquitin-conjugating enzyme E2 28 OS=Arabidopsis ... [more]
UBC10_ARATH5.591e-6395.96Ubiquitin-conjugating enzyme E2 10 OS=Arabidopsis ... [more]
UBC11_ARATH2.994e-6191.92Ubiquitin-conjugating enzyme E2 11 OS=Arabidopsis ... [more]
UBC29_ARATH7.869e-5986.87Ubiquitin-conjugating enzyme E2 29 OS=Arabidopsis ... [more]
UBC30_ARATH1.338e-5886.87Ubiquitin-conjugating enzyme E2 30 OS=Arabidopsis ... [more]
UBC4_SCHPO1.438e-5479.80Ubiquitin-conjugating enzyme E2 4 OS=Schizosacchar... [more]
UBC1_MAGGR5.416e-5478.79Ubiquitin-conjugating enzyme E2-16 kDa OS=Magnapor... [more]
back to top
Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide)
Total hits: 10
Match NameE-valueIdentityDescription
AT4G27960.21.005e-6497.98| Symbols: UBC9 | ubiquitin conjugating enzyme 9 |... [more]
AT4G27960.11.008e-6497.98| Symbols: UBC9 | ubiquitin conjugating enzyme 9 |... [more]
AT5G41700.51.314e-6497.98| Symbols: UBC8 | ubiquitin conjugating enzyme 8 |... [more]
AT5G41700.11.314e-6497.98| Symbols: UBC8, ATUBC8 | ubiquitin conjugating en... [more]
AT5G41700.21.314e-6497.98| Symbols: UBC8, ATUBC8 | ubiquitin conjugating en... [more]
AT1G64230.21.314e-6496.97| Symbols: UBC28 | ubiquitin-conjugating enzyme 28... [more]
AT1G64230.11.314e-6496.97| Symbols: UBC28 | ubiquitin-conjugating enzyme 28... [more]
AT5G53300.46.460e-6495.96| Symbols: UBC10 | ubiquitin-conjugating enzyme 10... [more]
AT5G53300.26.460e-6495.96| Symbols: UBC10 | ubiquitin-conjugating enzyme 10... [more]
AT5G53300.16.460e-6495.96| Symbols: UBC10 | ubiquitin-conjugating enzyme 10... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000608Ubiquitin-conjugating enzyme, E2PFAMPF00179UQ_concoord: 39..134
score: 2.2
IPR000608Ubiquitin-conjugating enzyme, E2SMARTSM00212no descriptioncoord: 38..142
score: 3.3
IPR000608Ubiquitin-conjugating enzyme, E2PROSITEPS00183UBIQUITIN_CONJUGAT_1coord: 108..123
score
IPR000608Ubiquitin-conjugating enzyme, E2PROFILEPS50127UBIQUITIN_CONJUGAT_2coord: 38..134
score: 37
IPR016135Ubiquitin-conjugating enzyme/RWD-likeGENE3D3.10.110.10no descriptioncoord: 33..134
score: 1.5
IPR016135Ubiquitin-conjugating enzyme/RWD-likeSUPERFAMILY54495UBC-likecoord: 27..134
score: 4.8
IPR016135Ubiquitin-conjugating enzyme/RWD-likeGENE3D3.10.110.10no descriptioncoord: 9..53
score: 1.1
NoneNo IPR availablePANTHERPTHR11621UBIQUITIN-CONJUGATING ENZYME E2coord: 25..135
score: 5.2
NoneNo IPR availablePANTHERPTHR11621:SF29UBIQUITIN-CONJUGATING ENZYME E2coord: 25..135
score: 5.2
NoneNo IPR availableSEGsegsegcoord: 14..34
score
NoneNo IPR availablePANTHERPTHR11621UBIQUITIN-CONJUGATING ENZYME E2coord: 30..53
score: 6.8
NoneNo IPR availablePANTHERPTHR11621:SF29UBIQUITIN-CONJUGATING ENZYME E2coord: 30..53
score: 6.8
NoneNo IPR availableSEGsegsegcoord: 5..21
score

Properties
Property NameValue
Singlet in analysisPisum sativum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>CD858744 ID=CD858744|Name=CD858744|organism=Pisum sativum|type=EST|length=478bp
TATGTGCGATTTCAGGCACCAAAGGGTCGTCGGGATTGGGATCCGTCAGC
AACGAGCAAATCGACAAGAGGACCTGGAAATGGTCAACGCTGGGCTCCAT
TGTTCTTTCAGAATGTCGAGACAGATACTTCCGTTGCTGTTGATGTTTGG
ATGGAATACCTTAGTCCTAAATGCAACCTTTGGTGGCTTGAATGGATAAT
CGGGAGGAAAGTGAATTGAAACCAAAAACACACCACCTGAATAGGGGCTA
TCAGCAGGTCCCATGATTGTTGCTTGCCAGTGAAACATGTCCTCAGCAAC
AGGACCTGCGCTGCATGAGGTAGGAGGATCCTTCTGCAAATCCTTGAGTT
CCTTGAGGATGCGTTTGGATGCCATGCTGAAAACCAAGGATTCGGAGGAA
GAAGATGAGAATTCGGGGAGAAGGTTGAAATTGAAAAGGGTTTGATCGAA
GAAGAATTGGATTTGATTTGAGTCAGGG
back to top
Annotated Terms
The following terms have been associated with this EST:
Vocabulary: Molecular Function
TermDefinition
GO:0016881acid-amino acid ligase activity
Vocabulary: Biological Process
TermDefinition
GO:0043687post-translational protein modification
Vocabulary: INTERPRO
TermDefinition
IPR000608UBQ-conjugat_E2
IPR016135UBQ-conjugating_enzyme/RWD