CD858843

EST Overview
NameCD858843
Unique NameCD858843
TypeEST
OrganismPisum sativum (pea)
Sequence length400
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
Pisum sativum unigene v12010-12-27
Homology Analysis: Pisum sativum unigene v1 vs Trembl2010-12-28
Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide2011-02-03
InterProScan analysis for Pisum sativum unigene v12010-12-29
Libraries
Library NameType
LIBEST_013997 CIcdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Pisum sativum unigene v1Pisum sativum unigene v1EST
Homology
BLAST of CD858843 vs. TrEMBL
Match: C6TAU1_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 217.624 bits (553), Expect = 3.138e-55
Identity = 113/131 (86.26%), Postives = 123/131 (93.89%), Query Frame = 3
Query:    3 LSGATIVDLSVNITLDSDYRLPPAALASSVTEGKTPGGADSALRKAEDVVTGMLAKGFILGKDAVNKAKGFDEKHQLTSTASAKVTSFDQKLGLSEKLTAGASVVSDRVKEVDQKFQVSEKTKSAFAAAEQ 395
            LSGATIVD+ V IT D DY+LPPAALASSV E +TPGGADSALRKAEDVV+GMLAKGFILGKDAVNKAK FDEKHQL+STASAKV SFDQK+GLSEK++AGA+VVSDRV+EVDQKFQVSEKTKSAFAAAEQ
Sbjct:   61 LSGATIVDMPVTITRDPDYQLPPAALASSVRETQTPGGADSALRKAEDVVSGMLAKGFILGKDAVNKAKTFDEKHQLSSTASAKVASFDQKIGLSEKISAGATVVSDRVREVDQKFQVSEKTKSAFAAAEQ 191          
BLAST of CD858843 vs. TrEMBL
Match: C6TJQ6_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 1.116e-52
Identity = 110/132 (83.33%), Postives = 121/132 (91.67%), Query Frame = 3
Query:    3 LSGATIVDLSVNITLDSDYRLPPAALASSVTEGKTPGG-ADSALRKAEDVVTGMLAKGFILGKDAVNKAKGFDEKHQLTSTASAKVTSFDQKLGLSEKLTAGASVVSDRVKEVDQKFQVSEKTKSAFAAAEQ 395
            LSGATIVD+ V I+LD DY+LPPAALAS V E +TPGG ADSA RKAEDVV+GMLAKGFILGKDAVNKAK FDEKHQL+STASAKV SFDQK+GLSEK++AGA+VV DRV+EVDQKFQVSEKTKSAFAAAEQ
Sbjct:   61 LSGATIVDMPVTISLDPDYQLPPAALASPVRETRTPGGGADSAFRKAEDVVSGMLAKGFILGKDAVNKAKTFDEKHQLSSTASAKVASFDQKIGLSEKISAGATVVGDRVREVDQKFQVSEKTKSAFAAAEQ 192          
BLAST of CD858843 vs. TrEMBL
Match: B9SRC6_RICCO (Nucleic acid binding protein, putative OS=Ricinus communis GN=RCOM_0614010 PE=4 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 1.364e-50
Identity = 104/132 (78.79%), Postives = 120/132 (90.91%), Query Frame = 3
Query:    3 LSGATIVDLSVNITLDSDYRLPPAALASSVTEGKTPGGADSALRKAEDVVTGMLAKGFILGKDAVNKAKGFDEKHQLTSTASAKVTSFDQKLGLSEKLTAGASVVSDRVKEVDQKFQVSEKTKSAFAAAEQK 398
            LSGATIVDLSV+ITLD DY+LPPA     VT+ KTPGGA+SALRKAEDVVT MLAKGFILGKDAVNKAK FD+KHQLTSTASAKV S D+K+GL++K++AG ++VSD+V+EVDQKFQVSEKTK+AFAAAEQK
Sbjct:   61 LSGATIVDLSVSITLDPDYQLPPA-----VTQNKTPGGAESALRKAEDVVTSMLAKGFILGKDAVNKAKTFDDKHQLTSTASAKVVSLDKKIGLTDKISAGTTIVSDKVREVDQKFQVSEKTKTAFAAAEQK 187          
BLAST of CD858843 vs. TrEMBL
Match: B7FIB3_MEDTR (Putative uncharacterized protein OS=Medicago truncatula PE=2 SV=1)

HSP 1 Score: 201.445 bits (511), Expect = 2.327e-50
Identity = 108/131 (82.44%), Postives = 115/131 (87.79%), Query Frame = 3
Query:    3 LSGATIVDLSVNITLDSDYRLPPAALASSVTEGKTPGGADSALRKAEDVVTGMLAKGFILGKDAVNKAKGFDEKHQLTSTASAKVTSFDQKLGLSEKLTAGASVVSDRVKEVDQKFQVSEKTKSAFAAAEQ 395
            LSGATIVDLSVNITLD DY+LPP AL S V+E KTPGGADSALRKAEDVVT M AKGFILGKDAVNKAK FDEK QL+S ASA V S DQKLGLS+K+ AGASVVSD+V+ VDQKF VSEKTKSAFAAAEQ
Sbjct:   61 LSGATIVDLSVNITLDPDYQLPPEALVSPVSESKTPGGADSALRKAEDVVTSMAAKGFILGKDAVNKAKTFDEKLQLSSKASATVASVDQKLGLSDKIGAGASVVSDKVRGVDQKFLVSEKTKSAFAAAEQ 191          
BLAST of CD858843 vs. TrEMBL
Match: B9MU59_POPTR (Predicted protein (Fragment) OS=Populus trichocarpa GN=POPTRDRAFT_423740 PE=4 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 5.184e-50
Identity = 102/132 (77.27%), Postives = 115/132 (87.12%), Query Frame = 3
Query:    3 LSGATIVDLSVNITLDSDYRLPPAALASSVTEGKTPGGADSALRKAEDVVTGMLAKGFILGKDAVNKAKGFDEKHQLTSTASAKVTSFDQKLGLSEKLTAGASVVSDRVKEVDQKFQVSEKTKSAFAAAEQK 398
            LSGATIVDLSV + LD DY+LPPAALA     G    G +SALRKAEDVV+GMLAKGFILGKDA+NKAKGFDEKHQLTSTASAKV SFD+K+GL+EK++AG +VV D+V+EVDQKFQVSEKTKSAFA AEQK
Sbjct:   61 LSGATIVDLSVTVALDPDYQLPPAALAELSATGNKAPGDESALRKAEDVVSGMLAKGFILGKDAINKAKGFDEKHQLTSTASAKVVSFDKKIGLTEKISAGTTVVGDKVREVDQKFQVSEKTKSAFAVAEQK 192          
BLAST of CD858843 vs. TrEMBL
Match: A9PE83_POPTR (Putative uncharacterized protein OS=Populus trichocarpa PE=2 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 5.184e-50
Identity = 102/132 (77.27%), Postives = 115/132 (87.12%), Query Frame = 3
Query:    3 LSGATIVDLSVNITLDSDYRLPPAALASSVTEGKTPGGADSALRKAEDVVTGMLAKGFILGKDAVNKAKGFDEKHQLTSTASAKVTSFDQKLGLSEKLTAGASVVSDRVKEVDQKFQVSEKTKSAFAAAEQK 398
            LSGATIVDLSV + LD DY+LPPAALA     G    G +SALRKAEDVV+GMLAKGFILGKDA+NKAKGFDEKHQLTSTASAKV SFD+K+GL+EK++AG +VV D+V+EVDQKFQVSEKTKSAFA AEQK
Sbjct:   61 LSGATIVDLSVTVALDPDYQLPPAALAELSATGNKAPGDESALRKAEDVVSGMLAKGFILGKDAINKAKGFDEKHQLTSTASAKVVSFDKKIGLTEKISAGTTVVGDKVREVDQKFQVSEKTKSAFAVAEQK 192          
BLAST of CD858843 vs. TrEMBL
Match: B9GZI4_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_646278 PE=4 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 1.081e-47
Identity = 100/132 (75.76%), Postives = 113/132 (85.61%), Query Frame = 3
Query:    3 LSGATIVDLSVNITLDSDYRLPPAALASSVTEGKTPGGADSALRKAEDVVTGMLAKGFILGKDAVNKAKGFDEKHQLTSTASAKVTSFDQKLGLSEKLTAGASVVSDRVKEVDQKFQVSEKTKSAFAAAEQK 398
            LSGATIVDL V +TLD DY+LPPAALA+  TE K P   +SAL KAEDVVTGMLAKGFILGKDA+NKAK FDEKHQLTSTASAKV S D+K+GL+EK++A  +VV D+V+EVDQKFQVSEKTK A AAAEQK
Sbjct:   65 LSGATIVDLPVTVTLDPDYQLPPAALAALATENKAPSD-ESALHKAEDVVTGMLAKGFILGKDAINKAKSFDEKHQLTSTASAKVASLDKKIGLTEKISASTTVVGDKVREVDQKFQVSEKTKLALAAAEQK 195          
BLAST of CD858843 vs. TrEMBL
Match: D7TTS9_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_12.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00013098001 PE=4 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 7.746e-46
Identity = 96/134 (71.64%), Postives = 115/134 (85.82%), Query Frame = 3
Query:    3 LSGATIVDLSVNITLDSDYRLPPAALASSVT--EGKTPGGADSALRKAEDVVTGMLAKGFILGKDAVNKAKGFDEKHQLTSTASAKVTSFDQKLGLSEKLTAGASVVSDRVKEVDQKFQVSEKTKSAFAAAEQK 398
            LSGATIVD+SV IT   DY+LPPAA ++     E KTPG A+SA RK EDVV+GMLAKG+ILGKDAVNKAK FDEKHQLTSTA++KV SFD+K+G +EK++AG SVV+++V+EVD KFQVS+KTKSAFAAAEQK
Sbjct:   61 LSGATIVDMSVTITPAPDYQLPPAAASAPPLPKENKTPGRAESAFRKTEDVVSGMLAKGYILGKDAVNKAKSFDEKHQLTSTATSKVVSFDKKIGFTEKISAGTSVVNEKVREVDHKFQVSDKTKSAFAAAEQK 194          
BLAST of CD858843 vs. TrEMBL
Match: A5BZQ5_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_028374 PE=4 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 2.943e-45
Identity = 95/132 (71.97%), Postives = 113/132 (85.61%), Query Frame = 3
Query:    9 GATIVDLSVNITLDSDYRLPPAALASSVT--EGKTPGGADSALRKAEDVVTGMLAKGFILGKDAVNKAKGFDEKHQLTSTASAKVTSFDQKLGLSEKLTAGASVVSDRVKEVDQKFQVSEKTKSAFAAAEQK 398
            GATIVD+SV IT   DY+LPPAA ++     E KTPG A+SA RK EDVV+GMLAKG+ILGKDAVNKAK FDEKHQLTSTA++KV SFD+K+G +EK++AG SVV+++V+EVD KFQVSEKTKSAFAAAEQK
Sbjct:  563 GATIVDMSVTITPAPDYQLPPAAASAPPLPKENKTPGRAESAFRKTEDVVSGMLAKGYILGKDAVNKAKSFDEKHQLTSTATSKVVSFDKKIGFTEKISAGTSVVNEKVREVDHKFQVSEKTKSAFAAAEQK 694          
BLAST of CD858843 vs. TrEMBL
Match: B9S228_RICCO (Nucleic acid binding protein, putative OS=Ricinus communis GN=RCOM_1326600 PE=4 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 3.046e-42
Identity = 89/132 (67.42%), Postives = 111/132 (84.09%), Query Frame = 3
Query:    3 LSGATIVDLSVNITLDSDYRLPPAA-LASSVTEGKTPGGADSALRKAEDVVTGMLAKGFILGKDAVNKAKGFDEKHQLTSTASAKVTSFDQKLGLSEKLTAGASVVSDRVKEVDQKFQVSEKTKSAFAAAEQ 395
            LSGATIVD SV I L  DY+LP AA + ++ TE  T  GA+SA +KAED+V+ MLAKGFILGKDAVNKAK FDEKHQ TSTA++KV S D+K+GL+EK++AG ++V+D+V+EVD+KF+VSE TKSAFAAAEQ
Sbjct:   61 LSGATIVDQSVTIELAPDYKLPAAASVPTTATESSTASGAESAFQKAEDIVSSMLAKGFILGKDAVNKAKAFDEKHQFTSTATSKVASLDEKIGLTEKISAGTTLVNDKVREVDEKFRVSETTKSAFAAAEQ 192          
BLAST of CD858843 vs. TAIR peptide
Match: AT4G17720.1 (| Symbols: | RNA-binding (RRM/RBD/RNP motifs) family protein | chr4:9862660-9864498 REVERSE LENGTH=313)

HSP 1 Score: 165.622 bits (418), Expect = 7.525e-42
Identity = 88/133 (66.17%), Postives = 105/133 (78.95%), Query Frame = 3
Query:    3 LSGATIVDLSVNITLDSDYRLPPAALASSVTE--GKTPGGADSALRKAEDVVTGMLAKGFILGKDAVNKAKGFDEKHQLTSTASAKVTSFDQKLGLSEKLTAGASVVSDRVKEVDQKFQVSEKTKSAFAAAEQ 395
            LSGATIVD SV +++  DY+L P ALAS   +   K+P   DS LRKAEDVV+ MLAKGFILGKDA+ KAK  DEKHQLTSTASAKV SFD+K+G ++K+  G  VV ++V+EVDQK+QVSEKTKSA AAAEQ
Sbjct:   61 LSGATIVDSSVIVSMAPDYQLSPEALASLEPKDSNKSPKAGDSVLRKAEDVVSSMLAKGFILGKDAIAKAKSVDEKHQLTSTASAKVASFDKKIGFTDKINTGTVVVGEKVREVDQKYQVSEKTKSAIAAAEQ 193          
BLAST of CD858843 vs. TAIR peptide
Match: AT5G46870.1 (| Symbols: | RNA-binding (RRM/RBD/RNP motifs) family protein | chr5:19015486-19016990 FORWARD LENGTH=295)

HSP 1 Score: 165.236 bits (417), Expect = 9.828e-42
Identity = 86/137 (62.77%), Postives = 108/137 (78.83%), Query Frame = 3
Query:    3 LSGATIVDLSVNITLDSDYRLPPAALAS-----SVTEGKTPGGAD-SALRKAEDVVTGMLAKGFILGKDAVNKAKGFDEKHQLTSTASAKVTSFDQKLGLSEKLTAGASVVSDRVKEVDQKFQVSEKTKSAFAAAEQ 395
            L+G+TIVD SV +T+  DY+LPP ALAS        +  +P   D S  RKAEDVV+GM++KGF+LGKDA+ KAK  DEKHQLTSTASA+VTSFD+++G +EK+  G +VVS++VKEVDQKFQV+EKTKSA AAAEQ
Sbjct:   61 LTGSTIVDSSVTVTMSPDYQLPPDALASIESLKESNKSSSPTREDVSVFRKAEDVVSGMISKGFVLGKDAIAKAKSLDEKHQLTSTASARVTSFDKRIGFTEKINTGTTVVSEKVKEVDQKFQVTEKTKSAIAAAEQ 197          
BLAST of CD858843 vs. TAIR peptide
Match: AT5G16840.3 (| Symbols: BPA1 | binding partner of acd11 1 | chr5:5536042-5538026 FORWARD LENGTH=257)

HSP 1 Score: 147.517 bits (371), Expect = 2.121e-36
Identity = 80/131 (61.07%), Postives = 99/131 (75.57%), Query Frame = 3
Query:    3 LSGATIVDLSVNITLDSDYRLPPAALASSVTEGKTPGGADSALRKAEDVVTGMLAKGFILGKDAVNKAKGFDEKHQLTSTASAKVTSFDQKLGLSEKLTAGASVVSDRVKEVDQKFQVSEKTKSAFAAAEQ 395
            LSGA+I D SV I L  +Y  P A  A + + G     A+S ++KAEDVV+ MLAKGFILGKDAV KAK FDEKH  TSTA+A V S DQK+GLS+KLTAG S+V++++K VDQ FQV+E+TKS +AAAEQ
Sbjct:   58 LSGASIADQSVIIELAPNYSPPAAPHAETQSSG-----AESVVQKAEDVVSSMLAKGFILGKDAVGKAKAFDEKHGFTSTATAGVASLDQKIGLSQKLTAGTSLVNEKIKAVDQNFQVTERTKSVYAAAEQ 183          
BLAST of CD858843 vs. TAIR peptide
Match: AT5G16840.2 (| Symbols: BPA1 | binding partner of acd11 1 | chr5:5536042-5538026 FORWARD LENGTH=260)

HSP 1 Score: 147.517 bits (371), Expect = 2.121e-36
Identity = 80/131 (61.07%), Postives = 99/131 (75.57%), Query Frame = 3
Query:    3 LSGATIVDLSVNITLDSDYRLPPAALASSVTEGKTPGGADSALRKAEDVVTGMLAKGFILGKDAVNKAKGFDEKHQLTSTASAKVTSFDQKLGLSEKLTAGASVVSDRVKEVDQKFQVSEKTKSAFAAAEQ 395
            LSGA+I D SV I L  +Y  P A  A + + G     A+S ++KAEDVV+ MLAKGFILGKDAV KAK FDEKH  TSTA+A V S DQK+GLS+KLTAG S+V++++K VDQ FQV+E+TKS +AAAEQ
Sbjct:   61 LSGASIADQSVIIELAPNYSPPAAPHAETQSSG-----AESVVQKAEDVVSSMLAKGFILGKDAVGKAKAFDEKHGFTSTATAGVASLDQKIGLSQKLTAGTSLVNEKIKAVDQNFQVTERTKSVYAAAEQ 186          
BLAST of CD858843 vs. TAIR peptide
Match: AT5G16840.1 (| Symbols: BPA1 | binding partner of acd11 1 | chr5:5536042-5538026 FORWARD LENGTH=259)

HSP 1 Score: 147.517 bits (371), Expect = 2.121e-36
Identity = 80/131 (61.07%), Postives = 99/131 (75.57%), Query Frame = 3
Query:    3 LSGATIVDLSVNITLDSDYRLPPAALASSVTEGKTPGGADSALRKAEDVVTGMLAKGFILGKDAVNKAKGFDEKHQLTSTASAKVTSFDQKLGLSEKLTAGASVVSDRVKEVDQKFQVSEKTKSAFAAAEQ 395
            LSGA+I D SV I L  +Y  P A  A + + G     A+S ++KAEDVV+ MLAKGFILGKDAV KAK FDEKH  TSTA+A V S DQK+GLS+KLTAG S+V++++K VDQ FQV+E+TKS +AAAEQ
Sbjct:   60 LSGASIADQSVIIELAPNYSPPAAPHAETQSSG-----AESVVQKAEDVVSSMLAKGFILGKDAVGKAKAFDEKHGFTSTATAGVASLDQKIGLSQKLTAGTSLVNEKIKAVDQNFQVTERTKSVYAAAEQ 185          
BLAST of CD858843 vs. TAIR peptide
Match: AT5G32450.1 (| Symbols: | RNA binding (RRM/RBD/RNP motifs) family protein | chr5:12079707-12081317 FORWARD LENGTH=267)

HSP 1 Score: 130.183 bits (326), Expect = 3.504e-31
Identity = 76/147 (51.70%), Postives = 97/147 (65.99%), Query Frame = 3
Query:    3 LSGATIVDLSVNITLDSDY-------------RLPPAALASSVTEGKT--PGGADSALRKAEDVVTGMLAKGFILGKDAVNKAKGFDEKHQLTSTASAKVTSFDQKLGLSEKLTAGASVVSDRVKEVDQKFQVSEKTKSAFAAAEQK 398
            LSGATIVD  V IT   +Y                P  L  S T+ KT   G + + + KA+DVV  +LAKG  LG+DAVNKAK FDEKHQL + ASAKV+SFD+++GL+EKL+ G S V+++VK VDQK QVS+KT +A  AAE+K
Sbjct:   62 LSGATIVDQIVTITRAENYVQRRETQEVRMLDNAMPLGLQESTTQTKTNMDGNSRAYVSKAQDVVATVLAKGSALGQDAVNKAKAFDEKHQLRANASAKVSSFDKRVGLTEKLSVGISAVNEKVKSVDQKLQVSDKTMAAIFAAERK 208          
BLAST of CD858843 vs. TAIR peptide
Match: AT1G67950.3 (| Symbols: | RNA-binding (RRM/RBD/RNP motifs) family protein | chr1:25478884-25480420 REVERSE LENGTH=279)

HSP 1 Score: 127.487 bits (319), Expect = 2.271e-30
Identity = 66/131 (50.38%), Postives = 94/131 (71.76%), Query Frame = 3
Query:    3 LSGATIVDLSVNITLDSDYRLPPAALASSVTEGKTPGGADSALRKAEDVVTGMLAKGFILGKDAVNKAKGFDEKHQLTSTASAKVTSFDQKLGLSEKLTAGASVVSDRVKEVDQKFQVSEKTKSAFAAAEQ 395
            L+GA I DL V+IT   +Y+LPP ALA    E    G    +++KAEDVV  M+ +G+ LGKDA+ KAK FD++H L S ASA + S D K+GLSEKL+ G +VV+++++++D+++QV E TKSA AAAE+
Sbjct:   86 LTGAVIADLRVSITPAVNYQLPPEALALDSQEHSFNG---FSVKKAEDVVNIMVGRGYALGKDAMEKAKAFDDRHNLISNASATIASLDDKMGLSEKLSIGTTVVNEKLRDIDERYQVREITKSALAAAEE 213          
BLAST of CD858843 vs. TAIR peptide
Match: AT1G67950.2 (| Symbols: | RNA-binding (RRM/RBD/RNP motifs) family protein | chr1:25478884-25480072 REVERSE LENGTH=279)

HSP 1 Score: 124.405 bits (311), Expect = 1.922e-29
Identity = 66/131 (50.38%), Postives = 95/131 (72.52%), Query Frame = 3
Query:    3 LSGATIVDLSVNITLDSDYRLPPAALASSVTEGKTPGGADSALRKAEDVVTGMLAKGFILGKDAVNKAKGFDEKHQLTSTASAKVTSFDQKLGLSEKLTAGASVVSDRVKEVDQKFQVSEKTKSAFAAAEQ 395
            L+GA I DL V+IT   +Y+LPP ALA   +E    G    +++KAEDVV  M+ +G+ LGKDA+ KAK FD++H L S ASA + S D K+GLSEKL+ G +VV+++++++D+++QV E TKSA AAAE+
Sbjct:   87 LTGAVIADLRVSITPAVNYQLPPEALALD-SEHSFNG---FSVKKAEDVVNIMVGRGYALGKDAMEKAKAFDDRHNLISNASATIASLDDKMGLSEKLSIGTTVVNEKLRDIDERYQVREITKSALAAAEE 213          
BLAST of CD858843 vs. TAIR peptide
Match: AT1G67950.1 (| Symbols: | RNA-binding (RRM/RBD/RNP motifs) family protein | chr1:25478884-25480420 REVERSE LENGTH=278)

HSP 1 Score: 124.405 bits (311), Expect = 1.922e-29
Identity = 66/131 (50.38%), Postives = 95/131 (72.52%), Query Frame = 3
Query:    3 LSGATIVDLSVNITLDSDYRLPPAALASSVTEGKTPGGADSALRKAEDVVTGMLAKGFILGKDAVNKAKGFDEKHQLTSTASAKVTSFDQKLGLSEKLTAGASVVSDRVKEVDQKFQVSEKTKSAFAAAEQ 395
            L+GA I DL V+IT   +Y+LPP ALA   +E    G    +++KAEDVV  M+ +G+ LGKDA+ KAK FD++H L S ASA + S D K+GLSEKL+ G +VV+++++++D+++QV E TKSA AAAE+
Sbjct:   86 LTGAVIADLRVSITPAVNYQLPPEALALD-SEHSFNG---FSVKKAEDVVNIMVGRGYALGKDAMEKAKAFDDRHNLISNASATIASLDDKMGLSEKLSIGTTVVNEKLRDIDERYQVREITKSALAAAEE 212          
BLAST of CD858843 vs. TAIR peptide
Match: AT1G67950.4 (| Symbols: | RNA-binding (RRM/RBD/RNP motifs) family protein | chr1:25478884-25479778 REVERSE LENGTH=219)

HSP 1 Score: 124.405 bits (311), Expect = 1.922e-29
Identity = 66/131 (50.38%), Postives = 95/131 (72.52%), Query Frame = 3
Query:    3 LSGATIVDLSVNITLDSDYRLPPAALASSVTEGKTPGGADSALRKAEDVVTGMLAKGFILGKDAVNKAKGFDEKHQLTSTASAKVTSFDQKLGLSEKLTAGASVVSDRVKEVDQKFQVSEKTKSAFAAAEQ 395
            L+GA I DL V+IT   +Y+LPP ALA   +E    G    +++KAEDVV  M+ +G+ LGKDA+ KAK FD++H L S ASA + S D K+GLSEKL+ G +VV+++++++D+++QV E TKSA AAAE+
Sbjct:   27 LTGAVIADLRVSITPAVNYQLPPEALALD-SEHSFNG---FSVKKAEDVVNIMVGRGYALGKDAMEKAKAFDDRHNLISNASATIASLDDKMGLSEKLSIGTTVVNEKLRDIDERYQVREITKSALAAAEE 153          
The following BLAST results are available for this feature:
BLAST of CD858843 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
C6TAU1_SOYBN3.138e-5586.26Putative uncharacterized protein OS=Glycine max PE... [more]
C6TJQ6_SOYBN1.116e-5283.33Putative uncharacterized protein OS=Glycine max PE... [more]
B9SRC6_RICCO1.364e-5078.79Nucleic acid binding protein, putative OS=Ricinus ... [more]
B7FIB3_MEDTR2.327e-5082.44Putative uncharacterized protein OS=Medicago trunc... [more]
B9MU59_POPTR5.184e-5077.27Predicted protein (Fragment) OS=Populus trichocarp... [more]
A9PE83_POPTR5.184e-5077.27Putative uncharacterized protein OS=Populus tricho... [more]
B9GZI4_POPTR1.081e-4775.76Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
D7TTS9_VITVI7.746e-4671.64Whole genome shotgun sequence of line PN40024, sca... [more]
A5BZQ5_VITVI2.943e-4571.97Putative uncharacterized protein OS=Vitis vinifera... [more]
B9S228_RICCO3.046e-4267.42Nucleic acid binding protein, putative OS=Ricinus ... [more]
back to top
BLAST of CD858843 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide)
Total hits: 10
Match NameE-valueIdentityDescription
AT4G17720.17.525e-4266.17| Symbols: | RNA-binding (RRM/RBD/RNP motifs) fam... [more]
AT5G46870.19.828e-4262.77| Symbols: | RNA-binding (RRM/RBD/RNP motifs) fam... [more]
AT5G16840.32.121e-3661.07| Symbols: BPA1 | binding partner of acd11 1 | chr... [more]
AT5G16840.22.121e-3661.07| Symbols: BPA1 | binding partner of acd11 1 | chr... [more]
AT5G16840.12.121e-3661.07| Symbols: BPA1 | binding partner of acd11 1 | chr... [more]
AT5G32450.13.504e-3151.70| Symbols: | RNA binding (RRM/RBD/RNP motifs) fam... [more]
AT1G67950.32.271e-3050.38| Symbols: | RNA-binding (RRM/RBD/RNP motifs) fam... [more]
AT1G67950.21.922e-2950.38| Symbols: | RNA-binding (RRM/RBD/RNP motifs) fam... [more]
AT1G67950.11.922e-2950.38| Symbols: | RNA-binding (RRM/RBD/RNP motifs) fam... [more]
AT1G67950.41.922e-2950.38| Symbols: | RNA-binding (RRM/RBD/RNP motifs) fam... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001395Aldo/keto reductasePANTHERPTHR11732ALDO/KETO REDUCTASEcoord: 1..132
score: 1.1
NoneNo IPR availablePANTHERPTHR11732:SF1ALDO/KETO REDUCTASEcoord: 1..132
score: 1.1
NoneNo IPR availableSEGsegsegcoord: 1..10
score

Properties
Property NameValue
Singlet in analysisPisum sativum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>CD858843 ID=CD858843|Name=CD858843|organism=Pisum sativum|type=EST|length=400bp
TACTATCGGGAGCAACAATAGTTGATTTGTCGGTTAACATAACTCTGGAT
TCAGATTACCGACTTCCACCTGCTGCCTTGGCATCATCTGTCACAGAGGG
TAAAACTCCTGGCGGTGCTGACTCTGCTTTACGGAAGGCAGAGGATGTGG
TCACCGGCATGCTTGCCAAGGGCTTTATTTTAGGGAAAGATGCTGTAAAC
AAAGCAAAGGGTTTTGATGAGAAGCACCAGTTAACTTCAACAGCCTCAGC
AAAAGTTACCTCTTTTGACCAAAAACTTGGGCTTAGCGAGAAATTAACTG
CTGGTGCTTCAGTTGTGAGTGATAGAGTTAAAGAAGTGGATCAAAAGTTT
CAGGTTTCAGAAAAGACCAAATCAGCATTTGCTGCTGCAGAACAGAAAGT
back to top
Annotated Terms
The following terms have been associated with this EST:
Vocabulary: Molecular Function
TermDefinition
GO:0016491oxidoreductase activity
Vocabulary: Biological Process
TermDefinition
GO:0055114oxidation-reduction process
Vocabulary: INTERPRO
TermDefinition
IPR001395Aldo/ket_red/Kv-b