AA430942

EST Overview
NameAA430942
Unique NameAA430942
TypeEST
OrganismPisum sativum (pea)
Sequence length838
Libraries
Library NameType
LIBEST_000872 Whero seedling lambda ZapII cDNA librarycdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Pisum sativum unigene v2Pisum sativum unigene v2EST
Pisum sativum unigene v1Pisum sativum unigene v1EST
Homology
BLAST of AA430942 vs. TrEMBL
Match: B7FN07_MEDTR (Putative uncharacterized protein OS=Medicago truncatula PE=2 SV=1)

HSP 1 Score: 303.908 bits (777), Expect = 1.138e-80
Identity = 161/210 (76.67%), Postives = 172/210 (81.90%), Query Frame = 1
Query:    1 RGLKNYDLSSVGLKIVAALDSSNKTCEVLPKHAVCTSNLNRSRPIQIQSAKNANGFQMDYSSMEE------DEEYTYVTCHVPNKTFTKVYYDG---EVRRQQGHN--NNNDVGVVRRSXXXXXXXX----LFPTSNFLNSCHLCGKNLHGKDIYMYRGEKGFCSTECRSSQIMMDERKERCGSEA---VELSSSPYTRGQIFSTGILAV 576
            RGLKNYDL  VGLKIVAALD+ NKTCEVLPKHAVCTSNLNRS PIQIQS K+ N FQMDYSSM E      +EEYTYVTCHVPNKTFTKVYYDG   +VRRQQG+N  N N+VGVVRRS            +FPTS+FLNSC+LCGKNLHGKD+YMYRGEK FCSTECRSSQIMMDERKERCGSEA   VELSSSPY R QIFSTGILA+
Sbjct:   42 RGLKNYDLGGVGLKIVAALDN-NKTCEVLPKHAVCTSNLNRSGPIQIQSVKSPNRFQMDYSSMNEIDMESMEEEYTYVTCHVPNKTFTKVYYDGGEGDVRRQQGYNYINKNNVGVVRRSSPPPQIFIEPEPIFPTSSFLNSCNLCGKNLHGKDVYMYRGEKAFCSTECRSSQIMMDERKERCGSEASRSVELSSSPYARDQIFSTGILAI 250          
BLAST of AA430942 vs. TrEMBL
Match: C6TCK1_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 7.920e-66
Identity = 135/200 (67.50%), Postives = 148/200 (74.00%), Query Frame = 1
Query:    1 RGLKNYDLSSVGLKIVAALDSSNKTC--EVLPKHAVCTSNLNRSRPIQIQSAKNANGFQMDYSSMEEDEEYTYVTCHVPNKTFTKVYYDGEVRRQQGHNNNNDVGVVRRSXXXXXXXX---LFPTSNFLNSCHLCGKNLHGKDIYMYRGEKGFCSTECRSSQIMMDERKERCGSEA---VELSSSPYTRGQIFSTGILAV 576
            RGLKNYDL  VGL IV ALD SN+    EVLPKHAVCTSNLNRS PI +   KN + F +        EEYTYVTCHVPNKTFTKVYYDG     + H NN++VGV+RR+           L+PTSNFL+SCHLCGK LHGKDIYMYRGEK FCS ECRSSQIMMDERKERC SEA   VE+SSSPY R QIFSTGILA+
Sbjct:   47 RGLKNYDLGGVGLGIVVALDKSNEVAAREVLPKHAVCTSNLNRSGPIPVHYTKNPDEFDV--------EEYTYVTCHVPNKTFTKVYYDGGEGEIRRHYNNSNVGVLRRTAPQPLIVEAESLYPTSNFLSSCHLCGKKLHGKDIYMYRGEKAFCSPECRSSQIMMDERKERCRSEASRSVEMSSSPYAREQIFSTGILAL 238          
BLAST of AA430942 vs. TrEMBL
Match: C6SX37_SOYBN (Putative uncharacterized protein (Fragment) OS=Glycine max PE=2 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 4.939e-60
Identity = 124/195 (63.59%), Postives = 138/195 (70.77%), Query Frame = 1
Query:    1 RGLKNYDLSSVGLKIVAALDSSNKTC---EVLPKHAVCTSNLNRSRPIQIQSAKNANGFQMDYSSMEEDEEYTYVTCHVPNKTFTKVYYDGE----VRRQQGHNNN-NDVGVVRRSXXXXXXXX--LFPTSNFLNSCHLCGKNLHGKDIYMYRGEKGFCSTECRSSQIMMDERKERCGSEA---VELSSSPYTRG 546
            RGLKNYDL  VGL IV ALD SN      EVLPKH VCTSNLNRS PI +   KN + F +        EEYTYVTC VPNKTFTK+YYDG     +RRQ  +NNN N+V V+RR+           +PTS+FL+SCHLCGK LHGKDIYMYRGEK FCS ECRSSQI MDERKERC SEA   VE+SSSPYT+G
Sbjct:   46 RGLKNYDLGGVGLGIVVALDKSNNEVAAREVLPKHTVCTSNLNRSGPIPVHYTKNPDEFDV--------EEYTYVTCRVPNKTFTKIYYDGGEGDIIRRQNNNNNNKNNVVVLRRTEPQPLIEPESSYPTSSFLSSCHLCGKKLHGKDIYMYRGEKAFCSPECRSSQITMDERKERCSSEASRSVEMSSSPYTKG 232          

HSP 2 Score: 28.8758 bits (63), Expect = 4.939e-60
Identity = 10/13 (76.92%), Postives = 12/13 (92.31%), Query Frame = 3
Query:  540 KGSNIFNWNSCGL 578
            KG+NIFNW+SC L
Sbjct:  231 KGTNIFNWDSCAL 243          
BLAST of AA430942 vs. TrEMBL
Match: D7TCB6_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_16.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00015039001 PE=4 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 3.230e-51
Identity = 118/205 (57.56%), Postives = 141/205 (68.78%), Query Frame = 1
Query:    1 RGLKNYDL-SSVGLKIVAALD-SSNKTCEVLPKHAVCTSNLNRSRPIQIQSAKNANGFQMDYSSMEED--EEYTYVTCHVPNK-TFTKVYYDG-EVRRQQGHNN----NNDVGVVRRSXXXXXXXXLFPTSNFLNSCHLCGKNLHGKDIYMYRGEKGFCSTECRSSQIMMDERKERCGSEA---VELSSSPYTRGQIFSTGILAV 576
            RG KNYDL S VGL IVAALD SSN   E+L K+AV  +N+ RS P+ + S KN    ++ +  +E D  E+YTYVTCH PNK +FT+VY+DG E      H +    +NDV               FPTS+FL+SCHLC KNLHGKDIYMYRGEK FCS ECRS QI+MDERKE+C SEA    ++SSSPYTRGQIFSTGILA+
Sbjct:   44 RGQKNYDLFSGVGLGIVAALDKSSNCRGEILAKYAVSGTNMGRSGPVPVTSGKNCGRLKVGFGELEMDSLEDYTYVTCHKPNKKSFTRVYFDGHETTAFHKHESPARFSNDVQA-------------FPTSDFLSSCHLCRKNLHGKDIYMYRGEKAFCSNECRSRQIVMDERKEQCRSEASRSADVSSSPYTRGQIFSTGILAI 235          
BLAST of AA430942 vs. TrEMBL
Match: A5AP27_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_039443 PE=4 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 6.092e-50
Identity = 114/200 (57.00%), Postives = 137/200 (68.50%), Query Frame = 1
Query:    1 RGLKNYDL-SSVGLKIVAALD-SSNKTCEVLPKHAVCTSNLNRSRPIQIQSAKNANGFQMDYSSMEED--EEYTYVTCHVPNK-TFTKVYYDGEVRRQQGHNNNNDVGVVRRSXXXXXXXXLFPTSNFLNSCHLCGKNLHGKDIYMYRGEKGFCSTECRSSQIMMDERKERCGSEA---VELSSSPYTRGQIFSTGILAV 576
            RG KNYDL   VGL IVAALD SSN   E+L K+AV  +NL RS P+ + S KN    ++ +  +E D  E+YTYVTCH PNK +FT+VY++G       H + +                 FPTS+FL+SCHLC KNLHGKDIYMYRGEK FCS ECRS QI+MDERKE+C SEA   V++SSSPYTRGQIFSTGILA+
Sbjct:   44 RGQKNYDLFXGVGLGIVAALDKSSNCGGEILAKYAVSGTNLGRSGPVPVTSGKNCGRLKVGFGELEMDSLEDYTYVTCHKPNKKSFTRVYFNGH-ETTAFHKHESPA-------RFSDDMQAFPTSDFLSSCHLCRKNLHGKDIYMYRGEKAFCSNECRSRQIVMDERKEQCRSEASRSVDVSSSPYTRGQIFSTGILAI 235          
BLAST of AA430942 vs. TrEMBL
Match: A9P948_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_589316 PE=2 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 1.500e-48
Identity = 109/206 (52.91%), Postives = 137/206 (66.50%), Query Frame = 1
Query:    1 RGLKNY-DLSSVGLKIVAALDSSNKTC---EVLPKHAVCTSNLNRSRPIQIQSAKNANGFQMDYSSMEED--EEYTYVTCHVPNKTFTKVYYDGEVRRQQGHNNN-NDVGVVRRSXXXXXXXX----LFPTSNFLNSCHLCGKNLHGKDIYMYRGEKGFCSTECRSSQIMMDERKERCGSE---AVELSSSPYTRGQIFSTGILAV 576
            +GLKNY DL  VGL IVAALD  + T    EVL K+AVC SNLNRS PI + S K+   F   +  M+    E+YTYVT H PN++FTKVYYDG    +QGH+    ++G                 ++PTS+FL+SCHLC K L+G+DIY+YRGEK FCS ECRSSQIM+DERKE+C SE   + ++SSSP+    IFSTGILA+
Sbjct:   44 KGLKNYHDLGGVGLGIVAALDKPSNTDVGHEVLAKYAVCRSNLNRSNPIPVNSGKDCEIFNCGFEEMDMKSLEDYTYVTIHAPNQSFTKVYYDGGEYGKQGHDRRCENMGCTSVPKGFPARLVEDVPVYPTSDFLSSCHLCRKKLYGRDIYIYRGEKAFCSVECRSSQIMIDERKEQCRSEVARSADVSSSPFKTSPIFSTGILAI 249          
BLAST of AA430942 vs. TrEMBL
Match: C6TK17_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 5.901e-45
Identity = 119/213 (55.87%), Postives = 135/213 (63.38%), Query Frame = 1
Query:    1 RGLKNYDLSSVGLKIVAALDSSNKTCEVLPKHAVCTSNLNRSRPIQIQSAKNANGFQMDYSSME--EDEEYTYVTCHVPN-KTFTKVYYDGEVRRQQGH-------NNNNDVGV--VRR----SXXXXXXXXLFPTSNFLNSCHLCGKNLHGKDIYMYRGEKGFCSTECRSSQIMM-DERKERCGSEA---VELSSSPYT-RGQIFSTGILAV 576
            +GLK+YDL  VGL IV ALD S+       +  VCTSN NRS PI +    N  GFQ   + +     E+YT+VT HVPN KT TKVYYDG       H       NNNN+VGV  VRR              +PTS+FL+SCHLC KNL GKDIYMYRGEK FCS ECRS QI M DERKERC SEA   VELSSSPYT R Q+FSTGI+A+
Sbjct:   48 KGLKSYDLGGVGLGIVVALDKSSSE----EQGHVCTSNSNRSVPIPVT---NQRGFQKGVNEIPAGSSEDYTFVTYHVPNNKTITKVYYDGGEGGILTHGYYNINNNNNNNVGVGGVRRIPPTQTLIEEDEQSYPTSDFLSSCHLCRKNLDGKDIYMYRGEKAFCSNECRSRQISMDDERKERCRSEASRSVELSSSPYTARDQMFSTGIVAL 253          
BLAST of AA430942 vs. TrEMBL
Match: B9RR72_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_0710760 PE=4 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 2.320e-41
Identity = 106/218 (48.62%), Postives = 134/218 (61.47%), Query Frame = 1
Query:    1 RGLKNYDLSSVGLKIVAALDSSNKTC--------EVLPKHAV-CTSN-LNRSRPIQIQSAKNANGFQMDYSSMEEDEEYTYVTCHVP-NKTFTKVYYDGEVRRQQGHNN-------NNDVGVVR-----RSXXXXXXXXLFPTSNFLNSCHLCGKNLHGKDIYMYRGEKGFCSTECRSSQIMMDERKERCGSE---AVELSSSPYTRGQIFSTGILAV 576
            RGLKNYDL  VGL IVAAL+ S  +         E+L K+A+ C+SN   RS PI ++   + +   ++  S+++   YTYVT H P NK+ TKVYYD     Q+GH         +N  GVV       +         +PTS+FL+SCHLC K LHGKDIYMYRGEK FCS ECRS QIM+DERKE+C SE   + ++SSSPYT   IFS GILA+
Sbjct:   47 RGLKNYDLGGVGLGIVAALEKSTYSSSDGTSSGHEILAKYAILCSSNNTTRSDPIPVKIGLSLHKEMLEIDSLDD---YTYVTTHGPDNKSMTKVYYD---HGQKGHRRIGFDSTTDNSFGVVSVIKETPAPARFVDEVAYPTSDFLSSCHLCKKKLHGKDIYMYRGEKAFCSAECRSRQIMIDERKEQCRSEVQRSADVSSSPYTTSPIFSAGILAI 258          
BLAST of AA430942 vs. TrEMBL
Match: A7Y7H9_PRUDU (Putative uncharacterized protein (Fragment) OS=Prunus dulcis PE=2 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 1.321e-28
Identity = 76/146 (52.05%), Postives = 94/146 (64.38%), Query Frame = 1
Query:    1 RGLKNYDLSSVGLKIVAALD-SSNKTCEVLPKHAVCTSNLNRSRPIQIQSAKNANGFQM-DYSSMEED--EEYTYVTCHVPNKTFTKVYYDG-EVRRQQGHNNNNDVGVVRRSXXXXXXXXLFPTSNFLNSCHLCGKNLHGKDIYM 423
            RGLKNYDL  VGL IVAAL+ SS+   E+L K+AVC  NLN+S PI + SA+N +GF        EED  E YTYVT    NK+FT+VYYDG + +    H+   D     ++        +FPTS+FL+SCHLC KNLHGKDIYM
Sbjct:   54 RGLKNYDLGGVGLGIVAALEKSSHNGREILAKYAVCGQNLNQSEPIPVSSAQNCDGFSTRGLPEFEEDSLENYTYVTQRGRNKSFTRVYYDGGDCKTSSMHHRVEDD---LQTCNDNNLASVFPTSDFLSSCHLCKKNLHGKDIYM 196          
BLAST of AA430942 vs. TrEMBL
Match: Q8GYX2_ARATH (At5g20700 OS=Arabidopsis thaliana GN=At5g20700/T1M15_100 PE=2 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 2.253e-28
Identity = 87/192 (45.31%), Postives = 110/192 (57.29%), Query Frame = 1
Query:   28 SVGLKIVAALDSSNKTCEVLPKHAVCTSNLN---RSRPIQIQSAKNANGFQMDYSSMEEDEEYTYVTCHV-PNKTFTKVYYDGEVRRQQGHNNNND-------VGVVRRSXXXXXXXXLFPTSNFLNSCHLCGKNLHGKDIYMYRGEKGFCSTECRSSQIMMDERKERCGSEAVELSSSPYTRGQIFSTGIL 570
            SVGL IVAAL++SN T  +    +VC S  N   RS P+Q  S   +   + +   + ++E+YT VTCH  P+ +     YD +         N+D       V VV  S         F    FLNSC+LC K LHG+DI++YRGEK FCSTECRSS I  DERKERC S   + S+SPYT GQIFSTG+L
Sbjct:   65 SVGLGIVAALENSN-TRRIT---SVCRSEPNQPGRSDPVQFMSHGGSTDGEDEEMFIMDEEDYTLVTCHHGPSGSCNTRVYDKDGFECFSSKINDDRRERLFVVDVVTESPENSPE---FQGLGFLNSCYLCRKKLHGQDIFIYRGEKAFCSTECRSSHIANDERKERCRS---KFSTSPYTAGQIFSTGVL 246          
BLAST of AA430942 vs. TAIR peptide
Match: AT5G20700.1 (| Symbols: | Protein of unknown function (DUF581) | chr5:7006178-7007003 REVERSE LENGTH=248)

HSP 1 Score: 130.183 bits (326), Expect = 1.421e-30
Identity = 87/192 (45.31%), Postives = 110/192 (57.29%), Query Frame = 1
Query:   28 SVGLKIVAALDSSNKTCEVLPKHAVCTSNLN---RSRPIQIQSAKNANGFQMDYSSMEEDEEYTYVTCHV-PNKTFTKVYYDGEVRRQQGHNNNND-------VGVVRRSXXXXXXXXLFPTSNFLNSCHLCGKNLHGKDIYMYRGEKGFCSTECRSSQIMMDERKERCGSEAVELSSSPYTRGQIFSTGIL 570
            SVGL IVAAL++SN T  +    +VC S  N   RS P+Q  S   +   + +   + ++E+YT VTCH  P+ +     YD +         N+D       V VV  S         F    FLNSC+LC K LHG+DI++YRGEK FCSTECRSS I  DERKERC S   + S+SPYT GQIFSTG+L
Sbjct:   65 SVGLGIVAALENSN-TRRIT---SVCRSEPNQPGRSDPVQFMSHGGSTDGEDEEMFIMDEEDYTLVTCHHGPSGSCNTRVYDKDGFECFSSKINDDRRERLFVVDVVTESPENSPE---FQGLGFLNSCYLCRKKLHGQDIFIYRGEKAFCSTECRSSHIANDERKERCRS---KFSTSPYTAGQIFSTGVL 246          
BLAST of AA430942 vs. TAIR peptide
Match: AT1G74940.1 (| Symbols: | Protein of unknown function (DUF581) | chr1:28146284-28147065 FORWARD LENGTH=222)

HSP 1 Score: 103.99 bits (258), Expect = 1.090e-22
Identity = 73/191 (38.22%), Postives = 97/191 (50.79%), Query Frame = 1
Query:   10 KNYDLSSVGLKIVAALDSSNKTCEVLPKHAVCTSNLNRSRPIQIQSAKNANGFQMDYSSMEEDEEYTYVTCHVPNKTFTKVYY--DGEVRRQQGHNNNNDVGVVRRSXXXXXXXXLFPTSNFLNSCHLCGKNLHGKDIYMYRGEKGFCSTECRSSQIMMDERKERCGSEA---VELSSSPYTRGQIFSTGI 567
            K +    VGL IVAAL+ ++             + +NR  P++          ++D S    DEEYTYVT   PN   TKVYY  DG    +  +   +   V            +   + FL+SC LC K L GKDIYMY+GE GFCS ECRS QIM DER+E+C ++     ++ SSPY  GQ  S G+
Sbjct:   51 KRFGSGGVGLGIVAALEETS-------------NGINRHDPVRYSGRFRCP--EIDLS----DEEYTYVTS--PNGP-TKVYYNDDGFELSENDYRRVHKPMVTVDEPPVIERQSVRGPTEFLSSCCLCKKKLQGKDIYMYKGEMGFCSAECRSVQIMNDERQEQCKTQVSRNADVLSSPYAAGQRLSAGV 219          
BLAST of AA430942 vs. TAIR peptide
Match: AT1G19200.1 (| Symbols: | Protein of unknown function (DUF581) | chr1:6625104-6625856 REVERSE LENGTH=215)

HSP 1 Score: 80.1073 bits (196), Expect = 1.686e-15
Identity = 70/197 (35.53%), Postives = 92/197 (46.70%), Query Frame = 1
Query:   10 KNYDLSS-VGLKIVAALDSSNKTCEVLPKHAVCTSNLNRSRPIQIQSAKNANGFQMDYS-SMEEDEEYTYVTCHVPNKTFTKVYYDGEVRRQQGHNNNNDVGVVRR------SXXXXXXXXLFPTSNFLNSCHLCGKNLHGKDIYMYRGEKGFCSTECRSSQIMMDERKERCGSEAVELSSSPYTRGQIFSTGILAV 576
            K YD    +GL IVAAL+ S+     +  + VC +            A+ +  FQ      + + EEYT VT        TKVYY  E   + GHN  N     R+               L    +FL SC LC K L GKDIYMY+G++GFCS ECRS +IM D  KE+    +VE+     T  +I S GI  +
Sbjct:   35 KRYDNGGGIGLGIVAALEKSS-----IGINPVCHTGAGSKG---FDLARYSKRFQFAAGIDLSDSEEYTCVTTR---DGLTKVYYKEE-EFEFGHNLLNGDQRWRKPIEIAEESPAKERRVLRDCPDFLTSCCLCKKKLQGKDIYMYKGDEGFCSKECRSLKIMEDSLKEQHKLTSVEV----LTGEEIASPGIFLI 215          
BLAST of AA430942 vs. TAIR peptide
Match: AT2G25690.2 (| Symbols: | Protein of unknown function (DUF581) | chr2:10940530-10941649 REVERSE LENGTH=324)

HSP 1 Score: 71.2478 bits (173), Expect = 7.833e-13
Identity = 43/110 (39.09%), Postives = 58/110 (52.73%), Query Frame = 1
Query:  160 NGFQMDYSSMEEDEEYTYVTCHVPNKTFTKVYYDGEVRRQQGHNNNNDVGVVRRSXXXXXXXXLFPTSNFLNSCHLCGKNLHG-KDIYMYRGEKGFCSTECRSSQIMMDE 486
            +G    +SS ++ E+YT +  H PN   T +Y D   R  + H N     +            +FP+ NFL  C+ C K L G  DIYMYR EK FCS ECRS ++M+DE
Sbjct:  205 SGSDNAFSSEDDMEDYTCIIAHGPNPKTTHIYGD---RVLECHKNE----LKGDEDNKEKFGSVFPSDNFLGICNFCNKKLGGGDDIYMYR-EKSFCSEECRSEEMMIDE 306          
BLAST of AA430942 vs. TAIR peptide
Match: AT2G25690.1 (| Symbols: | Protein of unknown function (DUF581) | chr2:10940530-10941649 REVERSE LENGTH=324)

HSP 1 Score: 71.2478 bits (173), Expect = 7.833e-13
Identity = 43/110 (39.09%), Postives = 58/110 (52.73%), Query Frame = 1
Query:  160 NGFQMDYSSMEEDEEYTYVTCHVPNKTFTKVYYDGEVRRQQGHNNNNDVGVVRRSXXXXXXXXLFPTSNFLNSCHLCGKNLHG-KDIYMYRGEKGFCSTECRSSQIMMDE 486
            +G    +SS ++ E+YT +  H PN   T +Y D   R  + H N     +            +FP+ NFL  C+ C K L G  DIYMYR EK FCS ECRS ++M+DE
Sbjct:  205 SGSDNAFSSEDDMEDYTCIIAHGPNPKTTHIYGD---RVLECHKNE----LKGDEDNKEKFGSVFPSDNFLGICNFCNKKLGGGDDIYMYR-EKSFCSEECRSEEMMIDE 306          
BLAST of AA430942 vs. TAIR peptide
Match: AT1G53903.1 (| Symbols: | Protein of unknown function (DUF581) | chr1:20132363-20132842 FORWARD LENGTH=126)

HSP 1 Score: 70.8626 bits (172), Expect = 1.023e-12
Identity = 32/55 (58.18%), Postives = 41/55 (74.55%), Query Frame = 1
Query:  367 FLNSCHLCGKNLH-GKDIYMYRGEKGFCSTECRSSQIMMDERKERCGSEAVELSS 528
            FL +CHLC K LH  KD+YMYRG+ GFCS ECR SQ+++D+RKE   S  + L+S
Sbjct:   42 FLKTCHLCNKQLHQDKDVYMYRGDLGFCSRECRESQMLIDDRKELEASTKMMLAS 96          
BLAST of AA430942 vs. TAIR peptide
Match: AT1G53885.1 (| Symbols: | Protein of unknown function (DUF581) | chr1:20119798-20120277 FORWARD LENGTH=126)

HSP 1 Score: 70.8626 bits (172), Expect = 1.023e-12
Identity = 32/55 (58.18%), Postives = 41/55 (74.55%), Query Frame = 1
Query:  367 FLNSCHLCGKNLH-GKDIYMYRGEKGFCSTECRSSQIMMDERKERCGSEAVELSS 528
            FL +CHLC K LH  KD+YMYRG+ GFCS ECR SQ+++D+RKE   S  + L+S
Sbjct:   42 FLKTCHLCNKQLHQDKDVYMYRGDLGFCSRECRESQMLIDDRKELEASTKMMLAS 96          
BLAST of AA430942 vs. TAIR peptide
Match: AT5G11460.1 (| Symbols: | Protein of unknown function (DUF581) | chr5:3657064-3658388 REVERSE LENGTH=344)

HSP 1 Score: 68.1662 bits (165), Expect = 6.631e-12
Identity = 49/138 (35.51%), Postives = 65/138 (47.10%), Query Frame = 1
Query:  181 SSMEEDEEYTYVTCHVPNKTFTKVYYDG---EVRRQQGHN----NNNDVGVVRRSXXXXXXXXLFPTSNFLNSCHLCGKNLH-GKDIYMYRGEKGFCSTECRSSQIMMDERKERCG-SEAVELSSSPYTRGQIFSTGI 567
            S ME  E+YT V  H PN   T  Y D     V R++  N    N  +               + P  +FL+ C+ C K L  G+DIYMY G K FCS+ECRS +I +DE  E     EA++  SS     +  S G+
Sbjct:  202 SDMEISEDYTCVISHGPNPKTTHFYGDQVMESVEREELKNRCCKNEKESIFAVAPLDLTTPVDVLPPKDFLSFCYGCSKKLGMGEDIYMYSGYKAFCSSECRSKEIDLDEEMEDGDEEEAIKSVSSSDKESKKKSNGV 339          
BLAST of AA430942 vs. TAIR peptide
Match: AT3G22550.1 (| Symbols: | Protein of unknown function (DUF581) | chr3:7991827-7992805 REVERSE LENGTH=267)

HSP 1 Score: 67.3958 bits (163), Expect = 1.131e-11
Identity = 40/106 (37.74%), Postives = 55/106 (51.89%), Query Frame = 1
Query:  181 SSMEEDEEYTYVTCHVPNKTFTKVYYDGEVRRQQGHNNNNDVGVVRRSXXXXXXXXLFPTSNFLNSCHLCGKNLHGKD-IYMYRGEKGFCSTECRSSQIMMDERKE 495
            S ME  E+YT VTCH PN     ++ +  V  Q G         V  S          P  +FL+ C  C K+L  +D I+MYRG++ FCS+ECRS ++MM E  +
Sbjct:  165 SDMELSEDYTCVTCHGPNPRTIHIFDNCIVESQPGVVFFRSSDPVNESDSDYS-----PPDSFLSCCCNCKKSLGPRDDIFMYRGDRAFCSSECRSIEMMMSEEND 265          
BLAST of AA430942 vs. TAIR peptide
Match: AT1G22160.1 (| Symbols: | Protein of unknown function (DUF581) | chr1:7823238-7823774 FORWARD LENGTH=147)

HSP 1 Score: 66.2402 bits (160), Expect = 2.520e-11
Identity = 29/48 (60.42%), Postives = 37/48 (77.08%), Query Frame = 1
Query:  358 TSNFLNSCHLCGKNL-HGKDIYMYRGEKGFCSTECRSSQIMMDERKER 498
            + +FL SC LC + L HG+DIYMYRG++ FCS ECR  QI +DERKE+
Sbjct:   75 SEDFLRSCSLCKRLLVHGRDIYMYRGDRAFCSLECRQQQITVDERKEK 122          
BLAST of AA430942 vs. TAIR peptide
Match: AT5G20700.1 (| Symbols: | Protein of unknown function (DUF581) | chr5:7006178-7007003 REVERSE LENGTH=248)

HSP 1 Score: 130.183 bits (326), Expect = 1.421e-30
Identity = 87/192 (45.31%), Postives = 110/192 (57.29%), Query Frame = 1
Query:   28 SVGLKIVAALDSSNKTCEVLPKHAVCTSNLN---RSRPIQIQSAKNANGFQMDYSSMEEDEEYTYVTCHV-PNKTFTKVYYDGEVRRQQGHNNNND-------VGVVRRSXXXXXXXXLFPTSNFLNSCHLCGKNLHGKDIYMYRGEKGFCSTECRSSQIMMDERKERCGSEAVELSSSPYTRGQIFSTGIL 570
            SVGL IVAAL++SN T  +    +VC S  N   RS P+Q  S   +   + +   + ++E+YT VTCH  P+ +     YD +         N+D       V VV  S         F    FLNSC+LC K LHG+DI++YRGEK FCSTECRSS I  DERKERC S   + S+SPYT GQIFSTG+L
Sbjct:   65 SVGLGIVAALENSN-TRRIT---SVCRSEPNQPGRSDPVQFMSHGGSTDGEDEEMFIMDEEDYTLVTCHHGPSGSCNTRVYDKDGFECFSSKINDDRRERLFVVDVVTESPENSPE---FQGLGFLNSCYLCRKKLHGQDIFIYRGEKAFCSTECRSSHIANDERKERCRS---KFSTSPYTAGQIFSTGVL 246          
BLAST of AA430942 vs. TAIR peptide
Match: AT1G74940.1 (| Symbols: | Protein of unknown function (DUF581) | chr1:28146284-28147065 FORWARD LENGTH=222)

HSP 1 Score: 103.99 bits (258), Expect = 1.090e-22
Identity = 73/191 (38.22%), Postives = 97/191 (50.79%), Query Frame = 1
Query:   10 KNYDLSSVGLKIVAALDSSNKTCEVLPKHAVCTSNLNRSRPIQIQSAKNANGFQMDYSSMEEDEEYTYVTCHVPNKTFTKVYY--DGEVRRQQGHNNNNDVGVVRRSXXXXXXXXLFPTSNFLNSCHLCGKNLHGKDIYMYRGEKGFCSTECRSSQIMMDERKERCGSEA---VELSSSPYTRGQIFSTGI 567
            K +    VGL IVAAL+ ++             + +NR  P++          ++D S    DEEYTYVT   PN   TKVYY  DG    +  +   +   V            +   + FL+SC LC K L GKDIYMY+GE GFCS ECRS QIM DER+E+C ++     ++ SSPY  GQ  S G+
Sbjct:   51 KRFGSGGVGLGIVAALEETS-------------NGINRHDPVRYSGRFRCP--EIDLS----DEEYTYVTS--PNGP-TKVYYNDDGFELSENDYRRVHKPMVTVDEPPVIERQSVRGPTEFLSSCCLCKKKLQGKDIYMYKGEMGFCSAECRSVQIMNDERQEQCKTQVSRNADVLSSPYAAGQRLSAGV 219          
BLAST of AA430942 vs. TAIR peptide
Match: AT1G19200.1 (| Symbols: | Protein of unknown function (DUF581) | chr1:6625104-6625856 REVERSE LENGTH=215)

HSP 1 Score: 80.1073 bits (196), Expect = 1.686e-15
Identity = 70/197 (35.53%), Postives = 92/197 (46.70%), Query Frame = 1
Query:   10 KNYDLSS-VGLKIVAALDSSNKTCEVLPKHAVCTSNLNRSRPIQIQSAKNANGFQMDYS-SMEEDEEYTYVTCHVPNKTFTKVYYDGEVRRQQGHNNNNDVGVVRR------SXXXXXXXXLFPTSNFLNSCHLCGKNLHGKDIYMYRGEKGFCSTECRSSQIMMDERKERCGSEAVELSSSPYTRGQIFSTGILAV 576
            K YD    +GL IVAAL+ S+     +  + VC +            A+ +  FQ      + + EEYT VT        TKVYY  E   + GHN  N     R+               L    +FL SC LC K L GKDIYMY+G++GFCS ECRS +IM D  KE+    +VE+     T  +I S GI  +
Sbjct:   35 KRYDNGGGIGLGIVAALEKSS-----IGINPVCHTGAGSKG---FDLARYSKRFQFAAGIDLSDSEEYTCVTTR---DGLTKVYYKEE-EFEFGHNLLNGDQRWRKPIEIAEESPAKERRVLRDCPDFLTSCCLCKKKLQGKDIYMYKGDEGFCSKECRSLKIMEDSLKEQHKLTSVEV----LTGEEIASPGIFLI 215          
BLAST of AA430942 vs. TAIR peptide
Match: AT2G25690.2 (| Symbols: | Protein of unknown function (DUF581) | chr2:10940530-10941649 REVERSE LENGTH=324)

HSP 1 Score: 71.2478 bits (173), Expect = 7.833e-13
Identity = 43/110 (39.09%), Postives = 58/110 (52.73%), Query Frame = 1
Query:  160 NGFQMDYSSMEEDEEYTYVTCHVPNKTFTKVYYDGEVRRQQGHNNNNDVGVVRRSXXXXXXXXLFPTSNFLNSCHLCGKNLHG-KDIYMYRGEKGFCSTECRSSQIMMDE 486
            +G    +SS ++ E+YT +  H PN   T +Y D   R  + H N     +            +FP+ NFL  C+ C K L G  DIYMYR EK FCS ECRS ++M+DE
Sbjct:  205 SGSDNAFSSEDDMEDYTCIIAHGPNPKTTHIYGD---RVLECHKNE----LKGDEDNKEKFGSVFPSDNFLGICNFCNKKLGGGDDIYMYR-EKSFCSEECRSEEMMIDE 306          
BLAST of AA430942 vs. TAIR peptide
Match: AT2G25690.1 (| Symbols: | Protein of unknown function (DUF581) | chr2:10940530-10941649 REVERSE LENGTH=324)

HSP 1 Score: 71.2478 bits (173), Expect = 7.833e-13
Identity = 43/110 (39.09%), Postives = 58/110 (52.73%), Query Frame = 1
Query:  160 NGFQMDYSSMEEDEEYTYVTCHVPNKTFTKVYYDGEVRRQQGHNNNNDVGVVRRSXXXXXXXXLFPTSNFLNSCHLCGKNLHG-KDIYMYRGEKGFCSTECRSSQIMMDE 486
            +G    +SS ++ E+YT +  H PN   T +Y D   R  + H N     +            +FP+ NFL  C+ C K L G  DIYMYR EK FCS ECRS ++M+DE
Sbjct:  205 SGSDNAFSSEDDMEDYTCIIAHGPNPKTTHIYGD---RVLECHKNE----LKGDEDNKEKFGSVFPSDNFLGICNFCNKKLGGGDDIYMYR-EKSFCSEECRSEEMMIDE 306          
BLAST of AA430942 vs. TAIR peptide
Match: AT1G53903.1 (| Symbols: | Protein of unknown function (DUF581) | chr1:20132363-20132842 FORWARD LENGTH=126)

HSP 1 Score: 70.8626 bits (172), Expect = 1.023e-12
Identity = 32/55 (58.18%), Postives = 41/55 (74.55%), Query Frame = 1
Query:  367 FLNSCHLCGKNLH-GKDIYMYRGEKGFCSTECRSSQIMMDERKERCGSEAVELSS 528
            FL +CHLC K LH  KD+YMYRG+ GFCS ECR SQ+++D+RKE   S  + L+S
Sbjct:   42 FLKTCHLCNKQLHQDKDVYMYRGDLGFCSRECRESQMLIDDRKELEASTKMMLAS 96          
BLAST of AA430942 vs. TAIR peptide
Match: AT1G53885.1 (| Symbols: | Protein of unknown function (DUF581) | chr1:20119798-20120277 FORWARD LENGTH=126)

HSP 1 Score: 70.8626 bits (172), Expect = 1.023e-12
Identity = 32/55 (58.18%), Postives = 41/55 (74.55%), Query Frame = 1
Query:  367 FLNSCHLCGKNLH-GKDIYMYRGEKGFCSTECRSSQIMMDERKERCGSEAVELSS 528
            FL +CHLC K LH  KD+YMYRG+ GFCS ECR SQ+++D+RKE   S  + L+S
Sbjct:   42 FLKTCHLCNKQLHQDKDVYMYRGDLGFCSRECRESQMLIDDRKELEASTKMMLAS 96          
BLAST of AA430942 vs. TAIR peptide
Match: AT5G11460.1 (| Symbols: | Protein of unknown function (DUF581) | chr5:3657064-3658388 REVERSE LENGTH=344)

HSP 1 Score: 68.1662 bits (165), Expect = 6.631e-12
Identity = 49/138 (35.51%), Postives = 65/138 (47.10%), Query Frame = 1
Query:  181 SSMEEDEEYTYVTCHVPNKTFTKVYYDG---EVRRQQGHN----NNNDVGVVRRSXXXXXXXXLFPTSNFLNSCHLCGKNLH-GKDIYMYRGEKGFCSTECRSSQIMMDERKERCG-SEAVELSSSPYTRGQIFSTGI 567
            S ME  E+YT V  H PN   T  Y D     V R++  N    N  +               + P  +FL+ C+ C K L  G+DIYMY G K FCS+ECRS +I +DE  E     EA++  SS     +  S G+
Sbjct:  202 SDMEISEDYTCVISHGPNPKTTHFYGDQVMESVEREELKNRCCKNEKESIFAVAPLDLTTPVDVLPPKDFLSFCYGCSKKLGMGEDIYMYSGYKAFCSSECRSKEIDLDEEMEDGDEEEAIKSVSSSDKESKKKSNGV 339          
BLAST of AA430942 vs. TAIR peptide
Match: AT3G22550.1 (| Symbols: | Protein of unknown function (DUF581) | chr3:7991827-7992805 REVERSE LENGTH=267)

HSP 1 Score: 67.3958 bits (163), Expect = 1.131e-11
Identity = 40/106 (37.74%), Postives = 55/106 (51.89%), Query Frame = 1
Query:  181 SSMEEDEEYTYVTCHVPNKTFTKVYYDGEVRRQQGHNNNNDVGVVRRSXXXXXXXXLFPTSNFLNSCHLCGKNLHGKD-IYMYRGEKGFCSTECRSSQIMMDERKE 495
            S ME  E+YT VTCH PN     ++ +  V  Q G         V  S          P  +FL+ C  C K+L  +D I+MYRG++ FCS+ECRS ++MM E  +
Sbjct:  165 SDMELSEDYTCVTCHGPNPRTIHIFDNCIVESQPGVVFFRSSDPVNESDSDYS-----PPDSFLSCCCNCKKSLGPRDDIFMYRGDRAFCSSECRSIEMMMSEEND 265          
BLAST of AA430942 vs. TAIR peptide
Match: AT1G22160.1 (| Symbols: | Protein of unknown function (DUF581) | chr1:7823238-7823774 FORWARD LENGTH=147)

HSP 1 Score: 66.2402 bits (160), Expect = 2.520e-11
Identity = 29/48 (60.42%), Postives = 37/48 (77.08%), Query Frame = 1
Query:  358 TSNFLNSCHLCGKNL-HGKDIYMYRGEKGFCSTECRSSQIMMDERKER 498
            + +FL SC LC + L HG+DIYMYRG++ FCS ECR  QI +DERKE+
Sbjct:   75 SEDFLRSCSLCKRLLVHGRDIYMYRGDRAFCSLECRQQQITVDERKEK 122          
BLAST of AA430942 vs. TrEMBL
Match: B7FN07_MEDTR (Putative uncharacterized protein OS=Medicago truncatula PE=2 SV=1)

HSP 1 Score: 303.908 bits (777), Expect = 1.389e-80
Identity = 161/210 (76.67%), Postives = 172/210 (81.90%), Query Frame = 1
Query:    1 RGLKNYDLSSVGLKIVAALDSSNKTCEVLPKHAVCTSNLNRSRPIQIQSAKNANGFQMDYSSMEE------DEEYTYVTCHVPNKTFTKVYYDG---EVRRQQGHN--NNNDVGVVRRSXXXXXXXX----LFPTSNFLNSCHLCGKNLHGKDIYMYRGEKGFCSTECRSSQIMMDERKERCGSEA---VELSSSPYTRGQIFSTGILAV 576
            RGLKNYDL  VGLKIVAALD+ NKTCEVLPKHAVCTSNLNRS PIQIQS K+ N FQMDYSSM E      +EEYTYVTCHVPNKTFTKVYYDG   +VRRQQG+N  N N+VGVVRRS            +FPTS+FLNSC+LCGKNLHGKD+YMYRGEK FCSTECRSSQIMMDERKERCGSEA   VELSSSPY R QIFSTGILA+
Sbjct:   42 RGLKNYDLGGVGLKIVAALDN-NKTCEVLPKHAVCTSNLNRSGPIQIQSVKSPNRFQMDYSSMNEIDMESMEEEYTYVTCHVPNKTFTKVYYDGGEGDVRRQQGYNYINKNNVGVVRRSSPPPQIFIEPEPIFPTSSFLNSCNLCGKNLHGKDVYMYRGEKAFCSTECRSSQIMMDERKERCGSEASRSVELSSSPYARDQIFSTGILAI 250          
BLAST of AA430942 vs. TrEMBL
Match: C6TCK1_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 9.660e-66
Identity = 135/200 (67.50%), Postives = 148/200 (74.00%), Query Frame = 1
Query:    1 RGLKNYDLSSVGLKIVAALDSSNKTC--EVLPKHAVCTSNLNRSRPIQIQSAKNANGFQMDYSSMEEDEEYTYVTCHVPNKTFTKVYYDGEVRRQQGHNNNNDVGVVRRSXXXXXXXX---LFPTSNFLNSCHLCGKNLHGKDIYMYRGEKGFCSTECRSSQIMMDERKERCGSEA---VELSSSPYTRGQIFSTGILAV 576
            RGLKNYDL  VGL IV ALD SN+    EVLPKHAVCTSNLNRS PI +   KN + F +        EEYTYVTCHVPNKTFTKVYYDG     + H NN++VGV+RR+           L+PTSNFL+SCHLCGK LHGKDIYMYRGEK FCS ECRSSQIMMDERKERC SEA   VE+SSSPY R QIFSTGILA+
Sbjct:   47 RGLKNYDLGGVGLGIVVALDKSNEVAAREVLPKHAVCTSNLNRSGPIPVHYTKNPDEFDV--------EEYTYVTCHVPNKTFTKVYYDGGEGEIRRHYNNSNVGVLRRTAPQPLIVEAESLYPTSNFLSSCHLCGKKLHGKDIYMYRGEKAFCSPECRSSQIMMDERKERCRSEASRSVEMSSSPYAREQIFSTGILAL 238          
BLAST of AA430942 vs. TrEMBL
Match: C6SX37_SOYBN (Putative uncharacterized protein (Fragment) OS=Glycine max PE=2 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 6.026e-60
Identity = 124/195 (63.59%), Postives = 138/195 (70.77%), Query Frame = 1
Query:    1 RGLKNYDLSSVGLKIVAALDSSNKTC---EVLPKHAVCTSNLNRSRPIQIQSAKNANGFQMDYSSMEEDEEYTYVTCHVPNKTFTKVYYDGE----VRRQQGHNNN-NDVGVVRRSXXXXXXXX--LFPTSNFLNSCHLCGKNLHGKDIYMYRGEKGFCSTECRSSQIMMDERKERCGSEA---VELSSSPYTRG 546
            RGLKNYDL  VGL IV ALD SN      EVLPKH VCTSNLNRS PI +   KN + F +        EEYTYVTC VPNKTFTK+YYDG     +RRQ  +NNN N+V V+RR+           +PTS+FL+SCHLCGK LHGKDIYMYRGEK FCS ECRSSQI MDERKERC SEA   VE+SSSPYT+G
Sbjct:   46 RGLKNYDLGGVGLGIVVALDKSNNEVAAREVLPKHTVCTSNLNRSGPIPVHYTKNPDEFDV--------EEYTYVTCRVPNKTFTKIYYDGGEGDIIRRQNNNNNNKNNVVVLRRTEPQPLIEPESSYPTSSFLSSCHLCGKKLHGKDIYMYRGEKAFCSPECRSSQITMDERKERCSSEASRSVEMSSSPYTKG 232          

HSP 2 Score: 28.8758 bits (63), Expect = 6.026e-60
Identity = 10/13 (76.92%), Postives = 12/13 (92.31%), Query Frame = 3
Query:  540 KGSNIFNWNSCGL 578
            KG+NIFNW+SC L
Sbjct:  231 KGTNIFNWDSCAL 243          
BLAST of AA430942 vs. TrEMBL
Match: D7TCB6_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_16.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00015039001 PE=4 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 3.940e-51
Identity = 118/205 (57.56%), Postives = 141/205 (68.78%), Query Frame = 1
Query:    1 RGLKNYDL-SSVGLKIVAALD-SSNKTCEVLPKHAVCTSNLNRSRPIQIQSAKNANGFQMDYSSMEED--EEYTYVTCHVPNK-TFTKVYYDG-EVRRQQGHNN----NNDVGVVRRSXXXXXXXXLFPTSNFLNSCHLCGKNLHGKDIYMYRGEKGFCSTECRSSQIMMDERKERCGSEA---VELSSSPYTRGQIFSTGILAV 576
            RG KNYDL S VGL IVAALD SSN   E+L K+AV  +N+ RS P+ + S KN    ++ +  +E D  E+YTYVTCH PNK +FT+VY+DG E      H +    +NDV               FPTS+FL+SCHLC KNLHGKDIYMYRGEK FCS ECRS QI+MDERKE+C SEA    ++SSSPYTRGQIFSTGILA+
Sbjct:   44 RGQKNYDLFSGVGLGIVAALDKSSNCRGEILAKYAVSGTNMGRSGPVPVTSGKNCGRLKVGFGELEMDSLEDYTYVTCHKPNKKSFTRVYFDGHETTAFHKHESPARFSNDVQA-------------FPTSDFLSSCHLCRKNLHGKDIYMYRGEKAFCSNECRSRQIVMDERKEQCRSEASRSADVSSSPYTRGQIFSTGILAI 235          
BLAST of AA430942 vs. TrEMBL
Match: A5AP27_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_039443 PE=4 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 7.431e-50
Identity = 114/200 (57.00%), Postives = 137/200 (68.50%), Query Frame = 1
Query:    1 RGLKNYDL-SSVGLKIVAALD-SSNKTCEVLPKHAVCTSNLNRSRPIQIQSAKNANGFQMDYSSMEED--EEYTYVTCHVPNK-TFTKVYYDGEVRRQQGHNNNNDVGVVRRSXXXXXXXXLFPTSNFLNSCHLCGKNLHGKDIYMYRGEKGFCSTECRSSQIMMDERKERCGSEA---VELSSSPYTRGQIFSTGILAV 576
            RG KNYDL   VGL IVAALD SSN   E+L K+AV  +NL RS P+ + S KN    ++ +  +E D  E+YTYVTCH PNK +FT+VY++G       H + +                 FPTS+FL+SCHLC KNLHGKDIYMYRGEK FCS ECRS QI+MDERKE+C SEA   V++SSSPYTRGQIFSTGILA+
Sbjct:   44 RGQKNYDLFXGVGLGIVAALDKSSNCGGEILAKYAVSGTNLGRSGPVPVTSGKNCGRLKVGFGELEMDSLEDYTYVTCHKPNKKSFTRVYFNGH-ETTAFHKHESPA-------RFSDDMQAFPTSDFLSSCHLCRKNLHGKDIYMYRGEKAFCSNECRSRQIVMDERKEQCRSEASRSVDVSSSPYTRGQIFSTGILAI 235          
BLAST of AA430942 vs. TrEMBL
Match: A9P948_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_589316 PE=2 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 1.830e-48
Identity = 109/206 (52.91%), Postives = 137/206 (66.50%), Query Frame = 1
Query:    1 RGLKNY-DLSSVGLKIVAALDSSNKTC---EVLPKHAVCTSNLNRSRPIQIQSAKNANGFQMDYSSMEED--EEYTYVTCHVPNKTFTKVYYDGEVRRQQGHNNN-NDVGVVRRSXXXXXXXX----LFPTSNFLNSCHLCGKNLHGKDIYMYRGEKGFCSTECRSSQIMMDERKERCGSE---AVELSSSPYTRGQIFSTGILAV 576
            +GLKNY DL  VGL IVAALD  + T    EVL K+AVC SNLNRS PI + S K+   F   +  M+    E+YTYVT H PN++FTKVYYDG    +QGH+    ++G                 ++PTS+FL+SCHLC K L+G+DIY+YRGEK FCS ECRSSQIM+DERKE+C SE   + ++SSSP+    IFSTGILA+
Sbjct:   44 KGLKNYHDLGGVGLGIVAALDKPSNTDVGHEVLAKYAVCRSNLNRSNPIPVNSGKDCEIFNCGFEEMDMKSLEDYTYVTIHAPNQSFTKVYYDGGEYGKQGHDRRCENMGCTSVPKGFPARLVEDVPVYPTSDFLSSCHLCRKKLYGRDIYIYRGEKAFCSVECRSSQIMIDERKEQCRSEVARSADVSSSPFKTSPIFSTGILAI 249          
BLAST of AA430942 vs. TrEMBL
Match: C6TK17_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 7.198e-45
Identity = 119/213 (55.87%), Postives = 135/213 (63.38%), Query Frame = 1
Query:    1 RGLKNYDLSSVGLKIVAALDSSNKTCEVLPKHAVCTSNLNRSRPIQIQSAKNANGFQMDYSSME--EDEEYTYVTCHVPN-KTFTKVYYDGEVRRQQGH-------NNNNDVGV--VRR----SXXXXXXXXLFPTSNFLNSCHLCGKNLHGKDIYMYRGEKGFCSTECRSSQIMM-DERKERCGSEA---VELSSSPYT-RGQIFSTGILAV 576
            +GLK+YDL  VGL IV ALD S+       +  VCTSN NRS PI +    N  GFQ   + +     E+YT+VT HVPN KT TKVYYDG       H       NNNN+VGV  VRR              +PTS+FL+SCHLC KNL GKDIYMYRGEK FCS ECRS QI M DERKERC SEA   VELSSSPYT R Q+FSTGI+A+
Sbjct:   48 KGLKSYDLGGVGLGIVVALDKSSSE----EQGHVCTSNSNRSVPIPVT---NQRGFQKGVNEIPAGSSEDYTFVTYHVPNNKTITKVYYDGGEGGILTHGYYNINNNNNNNVGVGGVRRIPPTQTLIEEDEQSYPTSDFLSSCHLCRKNLDGKDIYMYRGEKAFCSNECRSRQISMDDERKERCRSEASRSVELSSSPYTARDQMFSTGIVAL 253          
BLAST of AA430942 vs. TrEMBL
Match: B9RR72_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_0710760 PE=4 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 2.830e-41
Identity = 106/218 (48.62%), Postives = 134/218 (61.47%), Query Frame = 1
Query:    1 RGLKNYDLSSVGLKIVAALDSSNKTC--------EVLPKHAV-CTSN-LNRSRPIQIQSAKNANGFQMDYSSMEEDEEYTYVTCHVP-NKTFTKVYYDGEVRRQQGHNN-------NNDVGVVR-----RSXXXXXXXXLFPTSNFLNSCHLCGKNLHGKDIYMYRGEKGFCSTECRSSQIMMDERKERCGSE---AVELSSSPYTRGQIFSTGILAV 576
            RGLKNYDL  VGL IVAAL+ S  +         E+L K+A+ C+SN   RS PI ++   + +   ++  S+++   YTYVT H P NK+ TKVYYD     Q+GH         +N  GVV       +         +PTS+FL+SCHLC K LHGKDIYMYRGEK FCS ECRS QIM+DERKE+C SE   + ++SSSPYT   IFS GILA+
Sbjct:   47 RGLKNYDLGGVGLGIVAALEKSTYSSSDGTSSGHEILAKYAILCSSNNTTRSDPIPVKIGLSLHKEMLEIDSLDD---YTYVTTHGPDNKSMTKVYYD---HGQKGHRRIGFDSTTDNSFGVVSVIKETPAPARFVDEVAYPTSDFLSSCHLCKKKLHGKDIYMYRGEKAFCSAECRSRQIMIDERKEQCRSEVQRSADVSSSPYTTSPIFSAGILAI 258          
BLAST of AA430942 vs. TrEMBL
Match: A7Y7H9_PRUDU (Putative uncharacterized protein (Fragment) OS=Prunus dulcis PE=2 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 1.611e-28
Identity = 76/146 (52.05%), Postives = 94/146 (64.38%), Query Frame = 1
Query:    1 RGLKNYDLSSVGLKIVAALD-SSNKTCEVLPKHAVCTSNLNRSRPIQIQSAKNANGFQM-DYSSMEED--EEYTYVTCHVPNKTFTKVYYDG-EVRRQQGHNNNNDVGVVRRSXXXXXXXXLFPTSNFLNSCHLCGKNLHGKDIYM 423
            RGLKNYDL  VGL IVAAL+ SS+   E+L K+AVC  NLN+S PI + SA+N +GF        EED  E YTYVT    NK+FT+VYYDG + +    H+   D     ++        +FPTS+FL+SCHLC KNLHGKDIYM
Sbjct:   54 RGLKNYDLGGVGLGIVAALEKSSHNGREILAKYAVCGQNLNQSEPIPVSSAQNCDGFSTRGLPEFEEDSLENYTYVTQRGRNKSFTRVYYDGGDCKTSSMHHRVEDD---LQTCNDNNLASVFPTSDFLSSCHLCKKNLHGKDIYM 196          
BLAST of AA430942 vs. TrEMBL
Match: Q8GYX2_ARATH (At5g20700 OS=Arabidopsis thaliana GN=At5g20700/T1M15_100 PE=2 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 2.748e-28
Identity = 87/192 (45.31%), Postives = 110/192 (57.29%), Query Frame = 1
Query:   28 SVGLKIVAALDSSNKTCEVLPKHAVCTSNLN---RSRPIQIQSAKNANGFQMDYSSMEEDEEYTYVTCHV-PNKTFTKVYYDGEVRRQQGHNNNND-------VGVVRRSXXXXXXXXLFPTSNFLNSCHLCGKNLHGKDIYMYRGEKGFCSTECRSSQIMMDERKERCGSEAVELSSSPYTRGQIFSTGIL 570
            SVGL IVAAL++SN T  +    +VC S  N   RS P+Q  S   +   + +   + ++E+YT VTCH  P+ +     YD +         N+D       V VV  S         F    FLNSC+LC K LHG+DI++YRGEK FCSTECRSS I  DERKERC S   + S+SPYT GQIFSTG+L
Sbjct:   65 SVGLGIVAALENSN-TRRIT---SVCRSEPNQPGRSDPVQFMSHGGSTDGEDEEMFIMDEEDYTLVTCHHGPSGSCNTRVYDKDGFECFSSKINDDRRERLFVVDVVTESPENSPE---FQGLGFLNSCYLCRKKLHGQDIFIYRGEKAFCSTECRSSHIANDERKERCRS---KFSTSPYTAGQIFSTGVL 246          
BLAST of AA430942 vs. Lotus protein
Match: chr4.CM0006.140.r2.d (+ phase: 0 )

HSP 1 Score: 231.876 bits (590), Expect = 1.993e-61
Identity = 131/196 (66.84%), Postives = 145/196 (73.98%), Query Frame = 1
Query:    1 RGLKNYDLSSVGLKIVAALDSSNKTC-EVLPKHAVCTSNLNRSRPIQIQSAKNANGFQMDYSSMEEDEEYTYVTCHVPNKTFTKVYYDGEVRRQQGHNNNNDVGVVRRSXXXXXXXX-LFPTSNFLNSCHLCGKNLHGKDIYMYRGEKGFCSTECRSSQIMMDERKERCGSEA-VELSSSPY-TRGQIFSTGILAV 576
            RGLK+YDL  VGLKIV  LD S +   EVLPKHAVC+SN+NRS PI ++   +A     D  S+EE  E+TYVTCHVPNKTFTKVYYDG          N  VGV+RR+         LFPTSNFL+SC+LCGK LHGKDIYMYRGEKGFCS ECRSSQIMMDERKE C SEA VELSSSPY TR QIFSTGILA+
Sbjct:   44 RGLKSYDLGGVGLKIVVDLDKSCEVRREVLPKHAVCSSNMNRSGPIPVKKNSDARYEIDDQGSLEE--EFTYVTCHVPNKTFTKVYYDGG--EGDFGKKNGKVGVLRRTPPQNFEPEPLFPTSNFLSSCNLCGKKLHGKDIYMYRGEKGFCSQECRSSQIMMDERKEVCRSEASVELSSSPYTTREQIFSTGILAL 235          
BLAST of AA430942 vs. Lotus protein
Match: chr6.CM0013.810.r2.d (+ phase: 0 )

HSP 1 Score: 186.037 bits (471), Expect = 1.254e-47
Identity = 118/207 (57.00%), Postives = 132/207 (63.77%), Query Frame = 1
Query:    1 RGLK-NYDLSSVGLKIVAALDSSNKTCEVL-PKHAVCTSNLNRSRPIQIQSAKNANGFQMDYSSMEEDEEYTYVTCHVPNKTFTKV-YYDGEVRRQQGHN------NNNDVGVVRRSXXXXXXXX---LFPTSNFLNSCHLCGKNLHGKDIYMYRGEKGFCSTECRSSQIMMDERKERCGSEA---VELSSSPYTRGQIFSTGILAV 576
            RG+K +YD   VGL IVAALD S +  EVL PK AVC      S PI +Q+ K  N F        ED  YTYVT H PNKT TKV YYDG   R   H       N N VGV R++           LFPTS+FL+SCHLC K LHGKDIYMYRGEK FCSTECRSSQI MDERKERC S+A   VELSSS  +R Q+FSTGI+A+
Sbjct:   44 RGMKKSYDSGGVGLGIVAALDKSQQHHEVLLPKPAVC------SGPIPVQTVKRDNQFPKIVVGSPED--YTYVTYHEPNKTATKVVYYDGGEGRIFRHGYEYDIKNKNKVGVFRKTPPTQTSVKAESLFPTSDFLSSCHLCRKKLHGKDIYMYRGEKAFCSTECRSSQITMDERKERCRSKASRSVELSSSQNSRDQMFSTGIVAL 242          
BLAST of AA430942 vs. Lotus protein
Match: chr5.CM0072.40.r2.d (- phase: 0 )

HSP 1 Score: 78.1814 bits (191), Expect = 3.684e-15
Identity = 63/206 (30.58%), Postives = 92/206 (44.66%), Query Frame = 1
Query:   25 SSVGLKIVAALDSSN--KTCEVL--PKHAVCTSN---------LN-RSRPIQIQSAKNANGFQMDYSSMEEDEEYTYVTCHVPNKTFTKVYYDG--EVRR-------QQGHNNNNDVGVVRRSXXXXXXXXLFPTSNFLNSCHLCGKNL-HGKDIYMYRGEKGFCSTECRSSQIMMDERKERCGSEAVELSSSPYTRGQIFSTGIL 570
            SS  +K ++ L  SN     E+L  P H +  S+         LN  S P+   S+ N     +  S +E  E+YT V  H PN   T ++ D   EV         +       +  +             FP+ +FL  C+ C   L  G+DIY+YRGEK FCS  CR+ +IM+DE  E   S + E S    + G++F TG +
Sbjct:  211 SSSSMKNLSGLTGSNFDSDSEILSSPPHFIGGSHNPNTLPPAELNSNSNPVPASSSSNEFIKSLSASEIENSEDYTCVISHGPNPKTTHIFCDSILEVHANDLKKYCKSEEEEEEEAKLSSPMVNKLQTPNQFPSGDFLCVCYYCNNELVEGEDIYIYRGEKSFCSPACRAMEIMIDEELEEPDSSS-EKSLEGESGGELFETGFI 415          
BLAST of AA430942 vs. Lotus protein
Match: chr5.CM0200.1000.r2.m (+ phase: 0 )

HSP 1 Score: 71.633 bits (174), Expect = 3.448e-13
Identity = 38/111 (34.23%), Postives = 57/111 (51.35%), Query Frame = 1
Query:  181 SSMEEDEEYTYVTCHVPNKTFTKVYYDGEVRRQQGHNNNNDVGVVRRSXXXXXXXXLFPTSNFLNSCHLCGKNL-HGKDIYMYRGEKGFCSTECRSSQIMMDERKERCGSE 510
            S ME  E+YT VT H PN   T ++ +  +        +        +         +P+ +FL++C  C KNL  GKDIYMYRGE+ FCS ECR   ++++E   +  +E
Sbjct:  180 SEMELSEDYTRVTSHGPNPRTTHIFDNCIIGSSCFGAGSCSAASAMENGCFPHHTSYYPSESFLSNCFYCKKNLGQGKDIYMYRGERAFCSHECRYQGMLLEEGMSKLEAE 290          
BLAST of AA430942 vs. Lotus protein
Match: chr2.CM0021.1100.r2.a (- phase: 0 )

HSP 1 Score: 66.2402 bits (160), Expect = 1.449e-11
Identity = 29/45 (64.44%), Postives = 33/45 (73.33%), Query Frame = 1
Query:  364 NFLNSCHLCGKNLHGKDIYMYRGEKGFCSTECRSSQIMMDERKER 498
            +FL +CHLC K L  KDIYMYRG+  FCS ECR  QI MDE KE+
Sbjct:   75 HFLEACHLCNKPLGNKDIYMYRGDTPFCSEECRLEQIEMDEAKEK 119          
BLAST of AA430942 vs. Lotus protein
Match: LjSGA_041279.1 (- phase: 0 )

HSP 1 Score: 61.6178 bits (148), Expect = 3.568e-10
Identity = 28/48 (58.33%), Postives = 34/48 (70.83%), Query Frame = 1
Query:  358 TSNFLNSCHLCGKNL-HGKDIYMYRGEKGFCSTECRSSQIMMDERKER 498
            T +FL SC LC + L  G+DIYMYRG+  FCS ECR  Q+  DERKE+
Sbjct:   72 TPDFLRSCCLCRRRLVPGRDIYMYRGDSAFCSLECRQQQMKQDERKEK 119          
BLAST of AA430942 vs. Lotus protein
Match: chr3.CM0416.240.r2.m (+ phase: 0 )

HSP 1 Score: 61.6178 bits (148), Expect = 3.568e-10
Identity = 27/44 (61.36%), Postives = 34/44 (77.27%), Query Frame = 1
Query:  367 FLNSCHLCGKNLH-GKDIYMYRGEKGFCSTECRSSQIMMDERKE 495
            FL +C+LC K L   KDIYMYRG++GFCS ECR  QI++DE +E
Sbjct:   40 FLKNCNLCNKQLSPDKDIYMYRGDQGFCSIECRDRQIVLDEMRE 83          
BLAST of AA430942 vs. Lotus protein
Match: LjSGA_016532.2 (+ phase: 0 )

HSP 1 Score: 61.2326 bits (147), Expect = 4.660e-10
Identity = 32/65 (49.23%), Postives = 38/65 (58.46%), Query Frame = 1
Query:  352 FPTSNFLNSCHLCGKNL-HGKDIYMYRGEKGFCSTECRSSQIMMDERK----ERCGSEAVELSSS 531
            F    FL  C LC K L  GKDIYMY+G++ FCS ECR  QI MDE +    E C   A+  +SS
Sbjct:   58 FQEPAFLELCFLCRKRLMQGKDIYMYKGDRAFCSEECRCKQIFMDEEETVQTENCSMAAMRPTSS 122          
BLAST of AA430942 vs. Lotus protein
Match: chr1.CM0760.260.r2.m (- phase: 0 )

HSP 1 Score: 57.3806 bits (137), Expect = 6.729e-9
Identity = 37/122 (30.33%), Postives = 54/122 (44.26%), Query Frame = 1
Query:  181 SSMEEDEEYTYVTCHVPNKTFTKVYYDGEVRRQ----------QGHNNNNDVGVVRRSXXXXXXXXLFPTSNFLNSCHLCGKNLHGK-DIYMYRGEKGFCSTECRSSQIMMDERKERCGSEA 513
            S +E  E+YT V  H PN   T ++ D  +             +G +   ++                 +  FLN CH C K L  K DIY+Y G+K FCS ECR  +I  +E  E+  +E+
Sbjct:  284 SEIELSEDYTCVITHGPNPKITHIFGDCILETNAKVIKNYFKIEGMDKGMNMLGGNMMPPPQAPNQYSSSEYFLNFCHHCNKKLDKKEDIYIYGGDKAFCSLECREVEIKFNEELEKSKTES 405          
BLAST of AA430942 vs. Lotus protein
Match: LjSGA_081527.1 (- phase: 0 )

HSP 1 Score: 55.4546 bits (132), Expect = 2.557e-8
Identity = 25/46 (54.35%), Postives = 33/46 (71.74%), Query Frame = 1
Query:  364 NFLNSCHLCGKNL-HGKDIYMYRGEKGFCSTECRSSQIMMDERKER 498
            +FL +C LC K+L   +DI+MYRG+  FCS ECR  QI +DE KE+
Sbjct:   78 HFLEACFLCKKSLGDNRDIFMYRGDTPFCSEECRQEQIEIDEAKEK 123          
BLAST of AA430942 vs. Soybean peptides
Match: Glyma17g05520.1|PACid:16304508 ()

HSP 1 Score: 254.603 bits (649), Expect = 7.614e-68
Identity = 135/200 (67.50%), Postives = 148/200 (74.00%), Query Frame = 1
Query:    1 RGLKNYDLSSVGLKIVAALDSSNKTC--EVLPKHAVCTSNLNRSRPIQIQSAKNANGFQMDYSSMEEDEEYTYVTCHVPNKTFTKVYYDGEVRRQQGHNNNNDVGVVRRSXXXXXXXX---LFPTSNFLNSCHLCGKNLHGKDIYMYRGEKGFCSTECRSSQIMMDERKERCGSEA---VELSSSPYTRGQIFSTGILAV 576
            RGLKNYDL  VGL IV ALD SN+    EVLPKHAVCTSNLNRS PI +   KN + F +        EEYTYVTCHVPNKTFTKVYYDG     + H NN++VGV+RR+           L+PTSNFL+SCHLCGK LHGKDIYMYRGEK FCS ECRSSQIMMDERKERC SEA   VE+SSSPY R QIFSTGILA+
Sbjct:   47 RGLKNYDLGGVGLGIVVALDKSNEVAAREVLPKHAVCTSNLNRSGPIPVHYTKNPDEFDV--------EEYTYVTCHVPNKTFTKVYYDGGEGEIRRHYNNSNVGVLRRTAPQPLIVEAESLYPTSNFLSSCHLCGKKLHGKDIYMYRGEKAFCSPECRSSQIMMDERKERCRSEASRSVEMSSSPYAREQIFSTGILAL 238          
BLAST of AA430942 vs. Soybean peptides
Match: Glyma13g17220.1|PACid:16290583 ()

HSP 1 Score: 236.113 bits (601), Expect = 2.802e-62
Identity = 130/200 (65.00%), Postives = 142/200 (71.00%), Query Frame = 1
Query:    1 RGLKNYDLSSVGLKIVAALDSSNKTC---EVLPKHAVCTSNLNRSRPIQIQSAKNANGFQMDYSSMEEDEEYTYVTCHVPNKTFTKVYYDGE----VRRQQGHNNN-NDVGVVRRSXXXXXXXX--LFPTSNFLNSCHLCGKNLHGKDIYMYRGEKGFCSTECRSSQIMMDERKERCGSEA---VELSSSPYTRGQIFST 561
            RGLKNYDL  VGL IV ALD SN      EVLPKH VCTSNLNRS PI +   KN + F +        EEYTYVTC VPNKTFTKVYYDG     +RRQ  +NNN N+V V+RR+           +PTS+FL+SCHLCGK LHGKDIYMYRGEK FCS ECRSSQI MDERKERC SEA   VE+SSSPYTR QIFST
Sbjct:   46 RGLKNYDLGGVGLGIVVALDKSNNEVAAREVLPKHTVCTSNLNRSGPIPVHYTKNPDEFDV--------EEYTYVTCRVPNKTFTKVYYDGGEGDIIRRQNNNNNNKNNVVVLRRTEPQPLIEPESSYPTSSFLSSCHLCGKKLHGKDIYMYRGEKAFCSPECRSSQITMDERKERCSSEASRSVEMSSSPYTREQIFST 237          
BLAST of AA430942 vs. Soybean peptides
Match: Glyma09g08300.1|PACid:16275187 ()

HSP 1 Score: 185.267 bits (469), Expect = 5.673e-47
Identity = 119/213 (55.87%), Postives = 135/213 (63.38%), Query Frame = 1
Query:    1 RGLKNYDLSSVGLKIVAALDSSNKTCEVLPKHAVCTSNLNRSRPIQIQSAKNANGFQMDYSSME--EDEEYTYVTCHVPN-KTFTKVYYDGEVRRQQGH-------NNNNDVGV--VRR----SXXXXXXXXLFPTSNFLNSCHLCGKNLHGKDIYMYRGEKGFCSTECRSSQIMM-DERKERCGSEA---VELSSSPYT-RGQIFSTGILAV 576
            +GLK+YDL  VGL IV ALD S+       +  VCTSN NRS PI +    N  GFQ   + +     E+YT+VT HVPN KT TKVYYDG       H       NNNN+VGV  VRR              +PTS+FL+SCHLC KNL GKDIYMYRGEK FCS ECRS QI M DERKERC SEA   VELSSSPYT R Q+FSTGI+A+
Sbjct:   48 KGLKSYDLGGVGLGIVVALDKSSSE----EQGHVCTSNSNRSVPIPVT---NQRGFQKGVNEIPAGSSEDYTFVTYHVPNNKTITKVYYDGGEGGILTHGYYNINNNNNNNVGVGGVRRIPPTQTLIEEDEQSYPTSDFLSSCHLCRKNLDGKDIYMYRGEKAFCSNECRSRQISMDDERKERCRSEASRSVELSSSPYTARDQMFSTGIVAL 253          
BLAST of AA430942 vs. Soybean peptides
Match: Glyma15g19900.1|PACid:16299372 ()

HSP 1 Score: 136.346 bits (342), Expect = 3.022e-32
Identity = 87/165 (52.73%), Postives = 102/165 (61.82%), Query Frame = 1
Query:    1 RGLKNYDLSSVGLKIVAALDSSNKTCE----VLPKHAV-CTSNLNRSRPIQIQSAKNANGFQMDYSSME--EDEEYTYVTCHVPN-KTFTKVYYDGEVRRQQGH-------NNNNDVGV--VRR-----SXXXXXXXXLFPTSNFLNSCHLCGKNLHGKDIYMYR 429
            +GLK+YDL  VGL IV ALD  + + E    V+PKHAV CTSN NRS PI +   KN  GFQ   + +     E+YT+VT HVPN KT TKVYYDG  R    H       NNNN+VGV  VRR     +         +PTS+FL+SCHLC KNLHGKDIYMYR
Sbjct:   49 KGLKSYDLGGVGLGIVVALDKKSSSEEQGHDVVPKHAVICTSNSNRSVPIPV---KNHQGFQKGVNEIPVGSSEDYTFVTYHVPNNKTITKVYYDGGERGILTHGCYNINNNNNNNVGVGGVRRIPPTQTLNIEEDEPSYPTSDFLSSCHLCRKNLHGKDIYMYR 210          
BLAST of AA430942 vs. Soybean peptides
Match: Glyma06g07810.1|PACid:16262103 ()

HSP 1 Score: 81.2629 bits (199), Expect = 1.154e-15
Identity = 50/138 (36.23%), Postives = 67/138 (48.55%), Query Frame = 1
Query:  181 SSMEEDEEYTYVTCHVPNKTFTKVYYD------GEVRRQQGHNNNNDVGVVRRSXXXXXXXXLFPTSNFLNSCHLCGKNLH-GKDIYMYRGEKGFCSTECRSSQIMMDERKERCGSE-AVELSSSPYTRGQIFSTGIL 570
            S +E  E+YT V  H PN   T ++ D          +    N   + GV             +P+S+FL+ CH C K L  GKDIY+Y GEK FCS  CR+ +IM+DE  E+  +    E S  P     +F TGIL
Sbjct:  282 SEIELSEDYTCVISHGPNPKTTHIFGDCILETHSNAFKTHFKNEEKEHGVKPLGSNKLGSPKPYPSSDFLSFCHHCNKKLEEGKDIYIYGGEKAFCSLTCRAMEIMIDEELEKSNTNPPCESSPKPKLGELLFETGIL 419          
BLAST of AA430942 vs. Soybean peptides
Match: Glyma06g07810.4|PACid:16262106 ()

HSP 1 Score: 75.0998 bits (183), Expect = 8.268e-14
Identity = 46/130 (35.38%), Postives = 62/130 (47.69%), Query Frame = 1
Query:  181 SSMEEDEEYTYVTCHVPNKTFTKVYYD------GEVRRQQGHNNNNDVGVVRRSXXXXXXXXLFPTSNFLNSCHLCGKNLH-GKDIYMYRGEKGFCSTECRSSQIMMDERKERCGSEAVELSSSPYTRGQ 549
            S +E  E+YT V  H PN   T ++ D          +    N   + GV             +P+S+FL+ CH C K L  GKDIY+Y GEK FCS  CR+ +IM+DE  E+  +     SS     GQ
Sbjct:  282 SEIELSEDYTCVISHGPNPKTTHIFGDCILETHSNAFKTHFKNEEKEHGVKPLGSNKLGSPKPYPSSDFLSFCHHCNKKLEEGKDIYIYGGEKAFCSLTCRAMEIMIDEELEKSNTNPPCESSPKPKLGQ 411          
BLAST of AA430942 vs. Soybean peptides
Match: Glyma06g07810.3|PACid:16262105 ()

HSP 1 Score: 75.0998 bits (183), Expect = 8.268e-14
Identity = 46/130 (35.38%), Postives = 62/130 (47.69%), Query Frame = 1
Query:  181 SSMEEDEEYTYVTCHVPNKTFTKVYYD------GEVRRQQGHNNNNDVGVVRRSXXXXXXXXLFPTSNFLNSCHLCGKNLH-GKDIYMYRGEKGFCSTECRSSQIMMDERKERCGSEAVELSSSPYTRGQ 549
            S +E  E+YT V  H PN   T ++ D          +    N   + GV             +P+S+FL+ CH C K L  GKDIY+Y GEK FCS  CR+ +IM+DE  E+  +     SS     GQ
Sbjct:  282 SEIELSEDYTCVISHGPNPKTTHIFGDCILETHSNAFKTHFKNEEKEHGVKPLGSNKLGSPKPYPSSDFLSFCHHCNKKLEEGKDIYIYGGEKAFCSLTCRAMEIMIDEELEKSNTNPPCESSPKPKLGQ 411          
BLAST of AA430942 vs. Soybean peptides
Match: Glyma06g07810.2|PACid:16262104 ()

HSP 1 Score: 75.0998 bits (183), Expect = 8.268e-14
Identity = 46/130 (35.38%), Postives = 62/130 (47.69%), Query Frame = 1
Query:  181 SSMEEDEEYTYVTCHVPNKTFTKVYYD------GEVRRQQGHNNNNDVGVVRRSXXXXXXXXLFPTSNFLNSCHLCGKNLH-GKDIYMYRGEKGFCSTECRSSQIMMDERKERCGSEAVELSSSPYTRGQ 549
            S +E  E+YT V  H PN   T ++ D          +    N   + GV             +P+S+FL+ CH C K L  GKDIY+Y GEK FCS  CR+ +IM+DE  E+  +     SS     GQ
Sbjct:  282 SEIELSEDYTCVISHGPNPKTTHIFGDCILETHSNAFKTHFKNEEKEHGVKPLGSNKLGSPKPYPSSDFLSFCHHCNKKLEEGKDIYIYGGEKAFCSLTCRAMEIMIDEELEKSNTNPPCESSPKPKLGQ 411          
BLAST of AA430942 vs. Soybean peptides
Match: Glyma14g16730.1|PACid:16295563 ()

HSP 1 Score: 74.3294 bits (181), Expect = 1.410e-13
Identity = 59/177 (33.33%), Postives = 86/177 (48.59%), Query Frame = 1
Query:   61 SSNKTCEVLPKHAVCTSNLNRSRPIQIQSAKNANGFQMDYSS--MEEDEEYTYVTCHVPNKTFTKVY----YDGEVRRQQGHNNNNDVG--VVRRSXXXXXXXXLFPTSNFLNSCHLCGKNLH-GKDIYMYRGEKGFCSTECRSSQIMMDERKERCGSEAVELSSSPYTRGQIFSTG 564
            S N T  +LP      S LN S P+   +A  +N F    S+  +E  E+YT V  H PN   T ++     +      + H    + G  +   S         +P+ +FL+ C+ C K L  GKDIY+YRGEK FCS  CR  +IMMDE+++   + + E S      G++F TG
Sbjct:  206 SQNNTKILLP------SELN-SNPV---AAVYSNEFIESLSACEIENSEDYTCVISHGPNAKTTHIFCGCILETHANDSERHYKAEEEGKGLSLFSVNILHTPNQYPSHDFLSVCYHCNKKLEEGKDIYIYRGEKSFCSLSCREIEIMMDEQEK--SNSSPENSPKCGFGGEVFETG 370          
BLAST of AA430942 vs. Soybean peptides
Match: Glyma04g07720.1|PACid:16255226 ()

HSP 1 Score: 73.1738 bits (178), Expect = 3.142e-13
Identity = 50/149 (33.56%), Postives = 71/149 (47.65%), Query Frame = 1
Query:  145 SAKNANGF--QMDYSSMEEDEEYTYVTCHVPNKTFTKVYYD------GEVRRQQGHNNNNDVGVVRRSXXXXXXXXLFPTSNFLNSCHLCGKNLH-GKDIYMYRGEKGFCSTECRSSQIMMDERKERCGSE-AVELSSSPYTRGQIFST 561
            S  ++N F   +  S +E  E+YT V  H PN   T ++ D        V +    +   +  V             +P+S+FL+ CH C K L  GKDIY+Y GEK FCS  CR+ +IM+DE  E+  S    E S +P     +F T
Sbjct:  288 SISSSNEFIKSLSASEIELSEDYTCVISHGPNPKTTHIFGDCILETHSNVFKTHFKSEEKEKRVNPLGNNKLGSPNPYPSSDFLSFCHHCNKKLEEGKDIYIYGGEKAFCSFTCRAMEIMIDEELEKSTSNPPCENSPNPKLGELLFET 436          
BLAST of AA430942 vs. Medicago proteins
Match: IMGA|Medtr4g124930.1 (Unknown Protein (AHRD V1); contains Interpro domain(s) IPR007650 Protein of unknown function DUF581 chr04_pseudomolecule_IMGAG_V3.5 43718390-43721002 E EGN_Mt100125 20100825)

HSP 1 Score: 303.908 bits (777), Expect = 6.172e-83
Identity = 161/210 (76.67%), Postives = 172/210 (81.90%), Query Frame = 1
Query:    1 RGLKNYDLSSVGLKIVAALDSSNKTCEVLPKHAVCTSNLNRSRPIQIQSAKNANGFQMDYSSMEE------DEEYTYVTCHVPNKTFTKVYYDG---EVRRQQGHN--NNNDVGVVRRSXXXXXXXX----LFPTSNFLNSCHLCGKNLHGKDIYMYRGEKGFCSTECRSSQIMMDERKERCGSEA---VELSSSPYTRGQIFSTGILAV 576
            RGLKNYDL  VGLKIVAALD+ NKTCEVLPKHAVCTSNLNRS PIQIQS K+ N FQMDYSSM E      +EEYTYVTCHVPNKTFTKVYYDG   +VRRQQG+N  N N+VGVVRRS            +FPTS+FLNSC+LCGKNLHGKD+YMYRGEK FCSTECRSSQIMMDERKERCGSEA   VELSSSPY R QIFSTGILA+
Sbjct:   42 RGLKNYDLGGVGLKIVAALDN-NKTCEVLPKHAVCTSNLNRSGPIQIQSVKSPNRFQMDYSSMNEIDMESMEEEYTYVTCHVPNKTFTKVYYDGGEGDVRRQQGYNYINKNNVGVVRRSSPPPQIFIEPEPIFPTSSFLNSCNLCGKNLHGKDVYMYRGEKAFCSTECRSSQIMMDERKERCGSEASRSVELSSSPYARDQIFSTGILAI 250          
BLAST of AA430942 vs. Medicago proteins
Match: IMGA|Medtr2g042970.1 (Unknown Protein (AHRD V1); contains Interpro domain(s) IPR007650 Protein of unknown function DUF581 chr02_pseudomolecule_IMGAG_V3.5 15635445-15633594 E EGN_Mt100125 20100825)

HSP 1 Score: 182.956 bits (463), Expect = 1.588e-46
Identity = 109/210 (51.90%), Postives = 133/210 (63.33%), Query Frame = 1
Query:    1 RGLKNYDLSSVGLKIVAALDSSNKTC---EVLPKHAVCTSNLNRSRP---IQIQSAKNANGFQMDYSSMEEDEEYTYVTCH-VPNKTFTKVYYDG-EVRRQQGHN-------NNNDVGVVRRSXXXXXXXXL---FPTSNFLNSCHLCGKNLHGKDIYMYRGEKGFCSTECRSSQIMMDERKERCGSEAVELSSSPYTRGQIFSTGILAV 576
            +GLK+Y+   VGL IV ALD S+      EV+PKH VCT   N+S     I IQ+    NG   +   +   E+YTYVT H   NK  TKV+YDG E      H+       NNN+VGV +RS            +PT +FLNSCHLC KNLHGKDI+MYRGE  FCS ECRS QIMMDERKE+C S ++ELSSSPYT+ Q+FSTGI+A+
Sbjct:   47 KGLKSYEFGGVGLGIVVALDKSDNDFVGYEVVPKH-VCTPKTNQSGEPITIPIQNHHQQNGNFANEILVGSPEDYTYVTYHDESNKPITKVFYDGGEESGILKHDCYTSKNINNNNVGVFKRSPPTQTLAQAEPSYPTLDFLNSCHLCKKNLHGKDIFMYRGEIAFCSNECRSKQIMMDERKEKCRSSSMELSSSPYTKDQMFSTGIMAL 255          
BLAST of AA430942 vs. Medicago proteins
Match: IMGA|Medtr3g108290.1 (Os10g0422600 protein (Fragment) (AHRD V1 *-*- Q0IXM0_ORYSJ); contains Interpro domain(s) IPR007650 Protein of unknown function DUF581 chr03_pseudomolecule_IMGAG_V3.5 38631373-38628398 E EGN_Mt100125 20100825)

HSP 1 Score: 85.1149 bits (209), Expect = 4.506e-17
Identity = 52/139 (37.41%), Postives = 68/139 (48.92%), Query Frame = 1
Query:  181 SSMEEDEEYTYVTCHVPNKTFTKVYYDGEVRRQ---------QGHNNNNDVGVVRRSXXXXXXXXLFPTSNFLNSCHLCGKNL-HGKDIYMYRGEKGFCSTECRSSQIMMDERKERCGSEAVELSSSPYTRGQIFSTGI 567
            S +E  E+YT V  H PN   T ++ D  +            +   N  + GV             +P+S FL+ CH C K L  GKDIY+YRGEK FCS  CR+ +IM+DE  E+  S   E S+ P    QIF  GI
Sbjct:  268 SEIELSEDYTCVISHGPNPKTTHIFGDYILETHPDLSIKNHFKNEENEKEKGVTLMGNKLSQTPNQYPSSAFLSFCHHCDKKLDEGKDIYIYRGEKAFCSLTCRAIEIMIDEELEKSNSPC-ENSAKPKLGEQIFEAGI 405          
BLAST of AA430942 vs. Medicago proteins
Match: IMGA|Medtr1g071780.1 (Senescence-associated protein SAG102 (AHRD V1 ***- Q8LGS1_ARATH); contains Interpro domain(s) IPR007650 Protein of unknown function DUF581 chr01_pseudomolecule_IMGAG_V3.5 17804386-17805815 E EGN_Mt100125 20100825)

HSP 1 Score: 65.855 bits (159), Expect = 2.829e-11
Identity = 42/120 (35.00%), Postives = 57/120 (47.50%), Query Frame = 1
Query:  130 PIQIQSAKNANGFQMDYSSMEEDEEYTYVTCHVPNKTFTKVYYDGEVRRQQGHNNNNDVGVVRRSXXXXXXXXLFPTSNFLNSCHLCGKNL-HGKDIYMYRGEKGFCSTECRSSQIMMDE 486
            P   +S K+     +  S ME  EEYT V  H PN   T ++               D  VV  S           + NFL+ C+ C  +L H KDI++YRGEK FCS ECR  ++++DE
Sbjct:  134 PSMFESQKSV----LSLSEMELSEEYTCVISHGPNPKTTHIF---------------DNCVVEESYCSVTNSPHSFSMNFLSFCYTCKNHLEHTKDIFIYRGEKAFCSQECRHKEMVLDE 234          
BLAST of AA430942 vs. Medicago proteins
Match: IMGA|Medtr8g022950.1 (Unknown Protein (AHRD V1); contains Interpro domain(s) IPR007650 Protein of unknown function DUF581 chr08_pseudomolecule_IMGAG_V3.5 5827807-5826483 E EGN_Mt100125 20100825)

HSP 1 Score: 63.5438 bits (153), Expect = 1.404e-10
Identity = 28/44 (63.64%), Postives = 35/44 (79.55%), Query Frame = 1
Query:  367 FLNSCHLCGKNL-HGKDIYMYRGEKGFCSTECRSSQIMMDERKE 495
            FL +C+LC K L   KDIYMYRG++GFCS ECR+ QI++DE KE
Sbjct:   39 FLKTCNLCNKQLSQDKDIYMYRGDQGFCSIECRNRQIVLDEMKE 82          
BLAST of AA430942 vs. Medicago proteins
Match: IMGA|Medtr5g013770.1 (Unknown Protein (AHRD V1); contains Interpro domain(s) IPR007650 Protein of unknown function DUF581 chr05_pseudomolecule_IMGAG_V3.5 4179712-4181623 E EGN_Mt100125 20100825)

HSP 1 Score: 60.8474 bits (146), Expect = 9.100e-10
Identity = 27/45 (60.00%), Postives = 32/45 (71.11%), Query Frame = 1
Query:  364 NFLNSCHLCGKNLHGKDIYMYRGEKGFCSTECRSSQIMMDERKER 498
            +FL SC LC K L  KDI+MYRG+  FCS ECR  QI +DE KE+
Sbjct:   84 HFLQSCFLCKKALGNKDIFMYRGDTPFCSEECRQEQIEIDEAKEK 128          
BLAST of AA430942 vs. Medicago proteins
Match: IMGA|CU651566_1.1 (Unknown Protein (AHRD V1); contains Interpro domain(s) IPR007650 Protein of unknown function DUF581 CU651566.9 6700-5475 F EGN_Mt100125 20100825)

HSP 1 Score: 60.4622 bits (145), Expect = 1.188e-9
Identity = 25/47 (53.19%), Postives = 34/47 (72.34%), Query Frame = 1
Query:  364 NFLNSCHLCGKNL-HGKDIYMYRGEKGFCSTECRSSQIMMDERKERC 501
            +FL SC LC + L  G+DIYMY+G+  FCS ECR  Q+  DE+K++C
Sbjct:   89 DFLRSCFLCKRRLVPGRDIYMYKGDSAFCSLECRQQQMNQDEKKDKC 135          
BLAST of AA430942 vs. Medicago proteins
Match: IMGA|Medtr3g087700.1 (Unknown Protein (AHRD V1); contains Interpro domain(s) IPR007650 Protein of unknown function DUF581 chr03_pseudomolecule_IMGAG_V3.5 29017640-29016186 E EGN_Mt100125 20100825)

HSP 1 Score: 58.9214 bits (141), Expect = 3.458e-9
Identity = 27/48 (56.25%), Postives = 33/48 (68.75%), Query Frame = 1
Query:  358 TSNFLNSCHLCGKNLH-GKDIYMYRGEKGFCSTECRSSQIMMDERKER 498
            T +FL +C LC   L  G+DIYMYRG+  FCS ECR  QI  D+RKE+
Sbjct:  121 TPHFLRTCGLCNCRLAPGRDIYMYRGDTAFCSLECREQQIKQDKRKEK 168          
BLAST of AA430942 vs. Medicago proteins
Match: IMGA|Medtr4g120160.1 (Genomic DNA chromosome 5 TAC clone K14A3 (AHRD V1 *-*- Q9FGQ9_ARATH); contains Interpro domain(s) IPR007650 Protein of unknown function DUF581 chr04_pseudomolecule_IMGAG_V3.5 41654180-41653336 E EGN_Mt100125 20100825)

HSP 1 Score: 58.151 bits (139), Expect = 5.898e-9
Identity = 25/48 (52.08%), Postives = 32/48 (66.67%), Query Frame = 1
Query:  352 FPTSNFLNSCHLCGKNL-HGKDIYMYRGEKGFCSTECRSSQIMMDERK 492
            F  S FL+ C LC K L  GKDIYMY+G++ FCS +CR   I+ DE +
Sbjct:   57 FKVSTFLDQCFLCSKKLLPGKDIYMYKGDRAFCSVDCRCKHILADEEE 104          
BLAST of AA430942 vs. Medicago proteins
Match: IMGA|Medtr8g008840.1 (Unknown Protein (AHRD V1); contains Interpro domain(s) IPR007650 Protein of unknown function DUF581 chr08_pseudomolecule_IMGAG_V3.5 1123299-1122098 F EGN_Mt100125 20100825)

HSP 1 Score: 56.6102 bits (135), Expect = 1.716e-8
Identity = 26/46 (56.52%), Postives = 32/46 (69.57%), Query Frame = 1
Query:  364 NFLNSCHLCGKNL-HGKDIYMYRGEKGFCSTECRSSQIMMDERKER 498
            +FL +C+LC K L   KDI+MYRG   FCS ECR  QI +DE KE+
Sbjct:   37 HFLQACYLCRKPLGQNKDIFMYRGNTPFCSNECRQEQIEIDESKEK 82          
The following BLAST results are available for this feature:
BLAST of AA430942 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
B7FN07_MEDTR1.138e-8076.67Putative uncharacterized protein OS=Medicago trunc... [more]
C6TCK1_SOYBN7.920e-6667.50Putative uncharacterized protein OS=Glycine max PE... [more]
C6SX37_SOYBN4.939e-6063.59Putative uncharacterized protein (Fragment) OS=Gly... [more]
D7TCB6_VITVI3.230e-5157.56Whole genome shotgun sequence of line PN40024, sca... [more]
A5AP27_VITVI6.092e-5057.00Putative uncharacterized protein OS=Vitis vinifera... [more]
A9P948_POPTR1.500e-4852.91Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
C6TK17_SOYBN5.901e-4555.87Putative uncharacterized protein OS=Glycine max PE... [more]
B9RR72_RICCO2.320e-4148.62Putative uncharacterized protein OS=Ricinus commun... [more]
A7Y7H9_PRUDU1.321e-2852.05Putative uncharacterized protein (Fragment) OS=Pru... [more]
Q8GYX2_ARATH2.253e-2845.31At5g20700 OS=Arabidopsis thaliana GN=At5g20700/T1M... [more]
back to top
BLAST of AA430942 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide)
Total hits: 10
Match NameE-valueIdentityDescription
AT5G20700.11.421e-3045.31| Symbols: | Protein of unknown function (DUF581)... [more]
AT1G74940.11.090e-2238.22| Symbols: | Protein of unknown function (DUF581)... [more]
AT1G19200.11.686e-1535.53| Symbols: | Protein of unknown function (DUF581)... [more]
AT2G25690.27.833e-1339.09| Symbols: | Protein of unknown function (DUF581)... [more]
AT2G25690.17.833e-1339.09| Symbols: | Protein of unknown function (DUF581)... [more]
AT1G53903.11.023e-1258.18| Symbols: | Protein of unknown function (DUF581)... [more]
AT1G53885.11.023e-1258.18| Symbols: | Protein of unknown function (DUF581)... [more]
AT5G11460.16.631e-1235.51| Symbols: | Protein of unknown function (DUF581)... [more]
AT3G22550.11.131e-1137.74| Symbols: | Protein of unknown function (DUF581)... [more]
AT1G22160.12.520e-1160.42| Symbols: | Protein of unknown function (DUF581)... [more]
back to top
BLAST of AA430942 vs. TAIR peptide
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs TAIR 10 peptide)
Total hits: 10
Match NameE-valueIdentityDescription
AT5G20700.11.421e-3045.31| Symbols: | Protein of unknown function (DUF581)... [more]
AT1G74940.11.090e-2238.22| Symbols: | Protein of unknown function (DUF581)... [more]
AT1G19200.11.686e-1535.53| Symbols: | Protein of unknown function (DUF581)... [more]
AT2G25690.27.833e-1339.09| Symbols: | Protein of unknown function (DUF581)... [more]
AT2G25690.17.833e-1339.09| Symbols: | Protein of unknown function (DUF581)... [more]
AT1G53903.11.023e-1258.18| Symbols: | Protein of unknown function (DUF581)... [more]
AT1G53885.11.023e-1258.18| Symbols: | Protein of unknown function (DUF581)... [more]
AT5G11460.16.631e-1235.51| Symbols: | Protein of unknown function (DUF581)... [more]
AT3G22550.11.131e-1137.74| Symbols: | Protein of unknown function (DUF581)... [more]
AT1G22160.12.520e-1160.42| Symbols: | Protein of unknown function (DUF581)... [more]
back to top
BLAST of AA430942 vs. TrEMBL
Analysis Date: 2011-04-27 (Homology Analysis: Pisum sativum unigene v2 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
B7FN07_MEDTR1.389e-8076.67Putative uncharacterized protein OS=Medicago trunc... [more]
C6TCK1_SOYBN9.660e-6667.50Putative uncharacterized protein OS=Glycine max PE... [more]
C6SX37_SOYBN6.026e-6063.59Putative uncharacterized protein (Fragment) OS=Gly... [more]
D7TCB6_VITVI3.940e-5157.56Whole genome shotgun sequence of line PN40024, sca... [more]
A5AP27_VITVI7.431e-5057.00Putative uncharacterized protein OS=Vitis vinifera... [more]
A9P948_POPTR1.830e-4852.91Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
C6TK17_SOYBN7.198e-4555.87Putative uncharacterized protein OS=Glycine max PE... [more]
B9RR72_RICCO2.830e-4148.62Putative uncharacterized protein OS=Ricinus commun... [more]
A7Y7H9_PRUDU1.611e-2852.05Putative uncharacterized protein (Fragment) OS=Pru... [more]
Q8GYX2_ARATH2.748e-2845.31At5g20700 OS=Arabidopsis thaliana GN=At5g20700/T1M... [more]
back to top
BLAST of AA430942 vs. Lotus protein
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Lotus proteins)
Total hits: 10
Match NameE-valueIdentityDescription
chr4.CM0006.140.r2.d1.993e-6166.84+ phase: 0 [more]
chr6.CM0013.810.r2.d1.254e-4757.00+ phase: 0 [more]
chr5.CM0072.40.r2.d3.684e-1530.58- phase: 0 [more]
chr5.CM0200.1000.r2.m3.448e-1334.23+ phase: 0 [more]
chr2.CM0021.1100.r2.a1.449e-1164.44- phase: 0 [more]
LjSGA_041279.13.568e-1058.33- phase: 0 [more]
chr3.CM0416.240.r2.m3.568e-1061.36+ phase: 0 [more]
LjSGA_016532.24.660e-1049.23+ phase: 0 [more]
chr1.CM0760.260.r2.m6.729e-930.33- phase: 0 [more]
LjSGA_081527.12.557e-854.35- phase: 0 [more]
back to top
BLAST of AA430942 vs. Soybean peptides
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Soybean peptides)
Total hits: 10
Match NameE-valueIdentityDescription
Glyma17g05520.1|PACid:163045087.614e-6867.50[more]
Glyma13g17220.1|PACid:162905832.802e-6265.00[more]
Glyma09g08300.1|PACid:162751875.673e-4755.87[more]
Glyma15g19900.1|PACid:162993723.022e-3252.73[more]
Glyma06g07810.1|PACid:162621031.154e-1536.23[more]
Glyma06g07810.4|PACid:162621068.268e-1435.38[more]
Glyma06g07810.3|PACid:162621058.268e-1435.38[more]
Glyma06g07810.2|PACid:162621048.268e-1435.38[more]
Glyma14g16730.1|PACid:162955631.410e-1333.33[more]
Glyma04g07720.1|PACid:162552263.142e-1333.56[more]
back to top
BLAST of AA430942 vs. Medicago proteins
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Medicago proteins)
Total hits: 10
Match NameE-valueIdentityDescription
IMGA|Medtr4g124930.16.172e-8376.67Unknown Protein (AHRD V1); contains Interpro domai... [more]
IMGA|Medtr2g042970.11.588e-4651.90Unknown Protein (AHRD V1); contains Interpro domai... [more]
IMGA|Medtr3g108290.14.506e-1737.41Os10g0422600 protein (Fragment) (AHRD V1 *-*- Q0IX... [more]
IMGA|Medtr1g071780.12.829e-1135.00Senescence-associated protein SAG102 (AHRD V1 ***-... [more]
IMGA|Medtr8g022950.11.404e-1063.64Unknown Protein (AHRD V1); contains Interpro domai... [more]
IMGA|Medtr5g013770.19.100e-1060.00Unknown Protein (AHRD V1); contains Interpro domai... [more]
IMGA|CU651566_1.11.188e-953.19Unknown Protein (AHRD V1); contains Interpro domai... [more]
IMGA|Medtr3g087700.13.458e-956.25Unknown Protein (AHRD V1); contains Interpro domai... [more]
IMGA|Medtr4g120160.15.898e-952.08Genomic DNA chromosome 5 TAC clone K14A3 (AHRD V1 ... [more]
IMGA|Medtr8g008840.11.716e-856.52Unknown Protein (AHRD V1); contains Interpro domai... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v2
Date Performed: 2011-04-27
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007650Protein of unknown function DUF581PFAMPF04570DUF581coord: 113..165
score: 4.8
NoneNo IPR availableSEGsegsegcoord: 109..116
score
NoneNo IPR availableSEGsegsegcoord: 57..62
score
NoneNo IPR availableSEGsegsegcoord: 58..63
score
NoneNo IPR availableSEGsegsegcoord: 16..21
score

Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007650Protein of unknown function DUF581PFAMPF04570DUF581coord: 113..165
score: 4.8
NoneNo IPR availableSEGsegsegcoord: 109..116
score
NoneNo IPR availableSEGsegsegcoord: 57..62
score
NoneNo IPR availableSEGsegsegcoord: 58..63
score
NoneNo IPR availableSEGsegsegcoord: 16..21
score

Properties
Property NameValue
Singlet in analysisPisum sativum unigene v2
Singlet in analysisPisum sativum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>AA430942 ID=AA430942|Name=AA430942|organism=Pisum sativum|type=EST|length=838bp
AGAGGTTTAAAAAACTACGACCTCAGTAGCGTTGGTCTCAAGATCGTTGC
AGCTCTCGATAGCAGCAACAAAACATGTGAAGTTTTGCCTAAACACGCTG
TTTGTACATCGAATTTGAATCGATCAAGACCGATCCAAATTCAATCTGCG
AAAAACGCAAACGGGTTTCAAATGGATTATTCAAGTATGGAAGAAGATGA
AGAATACACATATGTCACATGCCATGTACCTAATAAAACCTTCACTAAGG
TTTATTACGACGGTGAAGTTCGGAGACAACAAGGTCACAACAACAACAAC
GACGTTGGTGTTGTAAGAAGATCCGAACCGGAACCGGAACCGGAACCATT
ATTTCCAACCTCAAATTTTCTTAATTCATGTCACTTATGCGGAAAGAATC
TACATGGAAAAGATATATACATGTATAGAGGTGAGAAAGGGTTTTGTAGC
ACAGAGTGTCGTTCGAGTCAAATAATGATGGATGAACGAAAAGAGAGGTG
TGGTTCAGAAGCTGTGGAATTGTCGAGTTCACCATATACAAGGGGTCAAA
TATTTTCAACTGGAATTCTTGCGGTTTAACTATTGATTAATTAGTATCTA
AATCTGGATTAAGAAAATCGATAGATACTGTTAAGTAAATAATAATAATA
ATAATAATATATATACGGCTATACTATGGTTAACTGTATGAATATTTATA
TGAGAATTAAGATAGATATAGCTCGATCGTAACCAAAACGAAATTTTTGA
TGAGAAATAATGAGAGAGTGGATTATTTTGATGTAATGATATTATGCCCA
AGGAATTATGAATTATGAACTCGAAATCTCAATTGCTT
back to top
Annotated Terms
The following terms have been associated with this EST:
Vocabulary: INTERPRO
TermDefinition
IPR007650Zf-FLZ_dom