AA430951

EST Overview
NameAA430951
Unique NameAA430951
TypeEST
OrganismPisum sativum (pea)
Sequence length638
Libraries
Library NameType
LIBEST_000872 Whero seedling lambda ZapII cDNA librarycdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Pisum sativum unigene v1Pisum sativum unigene v1EST
Homology
BLAST of AA430951 vs. TrEMBL
Match: B7FM69_MEDTR (Putative uncharacterized protein OS=Medicago truncatula PE=2 SV=1)

HSP 1 Score: 280.026 bits (715), Expect = 1.011e-73
Identity = 137/161 (85.09%), Postives = 149/161 (92.55%), Query Frame = 2
Query:    5 RPKLRISPTILLDVPRDSLIMSEEIFGPLLPIIMVDRIEESFEVINSGTKPLAAYIFTNNKNLKEQFVKTISAGGLVINDTTIHLAVHTLPFGGVGDSGVGAYHGKFSFDAFSHKKAVLYRSFFGDASIRYPPYTKTKFRLMKALMTGSIVGIIRAIFGKS 487
            + KLRISPT+LLDVPRDSLIMSEEIFGPLLPII VD+++ESF+VINS  KPLAAYIFTNN  LKEQFVKT+SAGGLVI+DTTIHLAVHTLPFGGVG+SGVGAYHGKFSFDAFSHKKAVLYRSFFGDASIRYPPYT TK RLMKALM G  + IIRA+FG+S
Sbjct:  328 KSKLRISPTVLLDVPRDSLIMSEEIFGPLLPIITVDKLDESFDVINSAPKPLAAYIFTNNNKLKEQFVKTVSAGGLVIDDTTIHLAVHTLPFGGVGESGVGAYHGKFSFDAFSHKKAVLYRSFFGDASIRYPPYTSTKTRLMKALMGGGFLAIIRALFGRS 488          
BLAST of AA430951 vs. TrEMBL
Match: B9S2Y3_RICCO (Aldehyde dehydrogenase, putative OS=Ricinus communis GN=RCOM_0563960 PE=3 SV=1)

HSP 1 Score: 256.914 bits (655), Expect = 9.168e-67
Identity = 123/156 (78.85%), Postives = 142/156 (91.03%), Query Frame = 2
Query:   14 LRISPTILLDVPRDSLIMSEEIFGPLLPIIMVDRIEESFEVINSGTKPLAAYIFTNNKNLKEQFVKTISAGGLVINDTTIHLAVHTLPFGGVGDSGVGAYHGKFSFDAFSHKKAVLYRSFFGDASIRYPPYTKTKFRLMKALMTGSIVGIIRAIFG 481
            L+I+PTIL+DVP+DSLIM+EEIFGPLLPI+MV++IEESF++INS TKPLAAY+FTN K LK+QFV  +SAGGLV+NDTT+HLAVHTLPFGGVG+SG GAYHGKFSFDAFSHKKAVLYRSF GDA+IRYPPYTK K RLMKAL+ G I  II A+FG
Sbjct:  336 LKIAPTILMDVPQDSLIMNEEIFGPLLPIVMVNKIEESFDLINSRTKPLAAYLFTNKKKLKQQFVTCVSAGGLVVNDTTVHLAVHTLPFGGVGESGTGAYHGKFSFDAFSHKKAVLYRSFTGDAAIRYPPYTKGKLRLMKALIGGGIWSIISALFG 491          
BLAST of AA430951 vs. TrEMBL
Match: B9GU23_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_754562 PE=3 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 1.014e-65
Identity = 119/158 (75.32%), Postives = 142/158 (89.87%), Query Frame = 2
Query:   14 LRISPTILLDVPRDSLIMSEEIFGPLLPIIMVDRIEESFEVINSGTKPLAAYIFTNNKNLKEQFVKTISAGGLVINDTTIHLAVHTLPFGGVGDSGVGAYHGKFSFDAFSHKKAVLYRSFFGDASIRYPPYTKTKFRLMKALMTGSIVGIIRAIFGKS 487
            L+ISPTIL+DVP DSLIM EEIFGPLLPI++V +IE+SF++INSGTKPLAAY+FTNNK LKEQFV ++SAGG+VIND  +HLA+HTLPFGGVG+SG G+YHGKFSFDAFSHKKAVLYRSF GDA++RYPPYT+ K RLMKA MT +   I+RA+FG+S
Sbjct:  323 LKISPTILVDVPCDSLIMKEEIFGPLLPILIVSKIEDSFDMINSGTKPLAAYLFTNNKKLKEQFVMSVSAGGVVINDIAMHLAIHTLPFGGVGESGTGSYHGKFSFDAFSHKKAVLYRSFMGDAALRYPPYTRGKLRLMKAFMTSNFWTILRALFGRS 480          
BLAST of AA430951 vs. TrEMBL
Match: B9H7G3_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_831510 PE=3 SV=1)

HSP 1 Score: 246.514 bits (628), Expect = 1.239e-63
Identity = 115/158 (72.78%), Postives = 142/158 (89.87%), Query Frame = 2
Query:   14 LRISPTILLDVPRDSLIMSEEIFGPLLPIIMVDRIEESFEVINSGTKPLAAYIFTNNKNLKEQFVKTISAGGLVINDTTIHLAVHTLPFGGVGDSGVGAYHGKFSFDAFSHKKAVLYRSFFGDASIRYPPYTKTKFRLMKALMTGSIVGIIRAIFGKS 487
            LRI+PTILL VP++SLIM EEIFGPLLPI+ V +IE+SF++I SGTKPLAAY+FTNNK LKEQF+ ++SAGG+VINDTT+HLAVH++PFGGVG+SG+G+YHGKFSFDAF+HKKAV+YRSF GDAS+RYPPYT  K RLMKAL+TG++  I+R + G S
Sbjct:  331 LRIAPTILLGVPQNSLIMKEEIFGPLLPILTVSKIEDSFDIIKSGTKPLAAYLFTNNKKLKEQFLMSVSAGGVVINDTTLHLAVHSVPFGGVGESGMGSYHGKFSFDAFTHKKAVVYRSFVGDASVRYPPYTLGKLRLMKALITGNVWTILRTLLGMS 488          
BLAST of AA430951 vs. TrEMBL
Match: D7KVK7_ARALY (ALDH3H1 OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_475854 PE=4 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 1.675e-60
Identity = 110/161 (68.32%), Postives = 137/161 (85.09%), Query Frame = 2
Query:    5 RPKLRISPTILLDVPRDSLIMSEEIFGPLLPIIMVDRIEESFEVINSGTKPLAAYIFTNNKNLKEQFVKTISAGGLVINDTTIHLAVHTLPFGGVGDSGVGAYHGKFSFDAFSHKKAVLYRSFFGDASIRYPPYTKTKFRLMKALMTGSIVGIIRAIFGKS 487
            R  L+I+PTILLDVP DSLIMSEEIFGPLLPI+ ++ +EESF+VI S  KPLAAY+FT+NK LKE+F  T+SAGG+V+ND  +HLA+HTLPFGGVG+SG+GAYHGKFSFDAFSHKKAVLYRS FGD+++RYPPY++ K RL+KAL+  +I  I + + G S
Sbjct:  324 RENLKIAPTILLDVPLDSLIMSEEIFGPLLPILTLNNLEESFDVIRSRPKPLAAYLFTHNKKLKERFAATVSAGGIVVNDIAVHLALHTLPFGGVGESGMGAYHGKFSFDAFSHKKAVLYRSLFGDSAVRYPPYSRGKLRLLKALVDSNIFDIFKVLLGLS 484          
BLAST of AA430951 vs. TrEMBL
Match: A8MQF0_ARATH (Uncharacterized protein At1g44170.3 OS=Arabidopsis thaliana GN=At1g44170 PE=3 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 4.873e-60
Identity = 108/159 (67.92%), Postives = 136/159 (85.53%), Query Frame = 2
Query:    5 RPKLRISPTILLDVPRDSLIMSEEIFGPLLPIIMVDRIEESFEVINSGTKPLAAYIFTNNKNLKEQFVKTISAGGLVINDTTIHLAVHTLPFGGVGDSGVGAYHGKFSFDAFSHKKAVLYRSFFGDASIRYPPYTKTKFRLMKALMTGSIVGIIRAIFG 481
            R  L+I+PTILLDVP DSLIMSEEIFGPLLPI+ ++ +EESF+VI S  KPLAAY+FT+NK LKE+F  T+SAGG+V+ND  +HLA+HTLPFGGVG+SG+GAYHGKFSFDAFSHKKAVLYRS FGD+++RYPPY++ K RL+KAL+  +I  + + + G
Sbjct:  261 RENLKIAPTILLDVPLDSLIMSEEIFGPLLPILTLNNLEESFDVIRSRPKPLAAYLFTHNKKLKERFAATVSAGGIVVNDIAVHLALHTLPFGGVGESGMGAYHGKFSFDAFSHKKAVLYRSLFGDSAVRYPPYSRGKLRLLKALVDSNIFDLFKVLLG 419          
BLAST of AA430951 vs. TrEMBL
Match: D7SWG5_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_31.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00022356001 PE=4 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 1.622e-55
Identity = 103/159 (64.78%), Postives = 132/159 (83.02%), Query Frame = 2
Query:   11 KLRISPTILLDVPRDSLIMSEEIFGPLLPIIMVDRIEESFEVINSGTKPLAAYIFTNNKNLKEQFVKTISAGGLVINDTTIHLAVHTLPFGGVGDSGVGAYHGKFSFDAFSHKKAVLYRSFFGDASIRYPPYTKTKFRLMKALMTGSIVGIIRAIFGKS 487
            +L+I+PTIL+DVP D+ IM EEIFGPLLPI+ V+ +EESF+VINS +KPLAAY+F+ NK L++ FV  ISAGG++INDT +HL V +LPFGGVG+SG+G+YHGKFSFDAFSHKKAVLYR F G++  RYPPYT  K +L+K L +G+IV I+ A+ G S
Sbjct:  388 QLKIAPTILVDVPEDTEIMKEEIFGPLLPILTVENLEESFDVINSKSKPLAAYLFSENKQLQKDFVNNISAGGMLINDTILHLTVSSLPFGGVGESGMGSYHGKFSFDAFSHKKAVLYRGFTGESPARYPPYTPGKLKLLKTLTSGNIVSILLALLGFS 546          
BLAST of AA430951 vs. TrEMBL
Match: A5AQ13_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_044129 PE=4 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 1.622e-55
Identity = 103/159 (64.78%), Postives = 132/159 (83.02%), Query Frame = 2
Query:   11 KLRISPTILLDVPRDSLIMSEEIFGPLLPIIMVDRIEESFEVINSGTKPLAAYIFTNNKNLKEQFVKTISAGGLVINDTTIHLAVHTLPFGGVGDSGVGAYHGKFSFDAFSHKKAVLYRSFFGDASIRYPPYTKTKFRLMKALMTGSIVGIIRAIFGKS 487
            +L+I+PTIL+DVP D+ IM EEIFGPLLPI+ V+ +EESF+VINS +KPLAAY+F+ NK L++ FV  ISAGG++INDT +HL V +LPFGGVG+SG+G+YHGKFSFDAFSHKKAVLYR F G++  RYPPYT  K +L+K L +G+IV I+ A+ G S
Sbjct:  381 QLKIAPTILVDVPEDTEIMKEEIFGPLLPILTVENLEESFDVINSKSKPLAAYLFSENKQLQKDFVNNISAGGMLINDTILHLTVSSLPFGGVGESGMGSYHGKFSFDAFSHKKAVLYRGFTGESPARYPPYTPGKLKLLKTLTSGNIVSILLALLGFS 539          
BLAST of AA430951 vs. TrEMBL
Match: B9H4N6_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_861574 PE=4 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 1.793e-54
Identity = 100/159 (62.89%), Postives = 128/159 (80.50%), Query Frame = 2
Query:   11 KLRISPTILLDVPRDSLIMSEEIFGPLLPIIMVDRIEESFEVINSGTKPLAAYIFTNNKNLKEQFVKTISAGGLVINDTTIHLAVHTLPFGGVGDSGVGAYHGKFSFDAFSHKKAVLYRSFFGDASIRYPPYTKTKFRLMKALMTGSIVGIIRAIFGKS 487
            KL+I+PTI LDVP DS +M EEIFGPLLPII V+ +++S ++INS  +PL AY+FTNN+ L+  FV+ +S GG+VINDT +H+ V +LPFGGVG+SG+G+YHGKFSFDAFSHKKAVLYRSF GD+ +RYPPYT    +LM+A+M G I  II A+ G S
Sbjct:  328 KLKIAPTIFLDVPEDSQLMQEEIFGPLLPIITVENVKDSIDLINSKPEPLVAYLFTNNQKLRNDFVQNVSCGGMVINDTVLHVTVSSLPFGGVGESGMGSYHGKFSFDAFSHKKAVLYRSFSGDSPVRYPPYTPENKKLMRAVMNGGIFDIILALMGWS 486          
BLAST of AA430951 vs. TrEMBL
Match: Q2PQL8_BRACM (Putative aldehyde dehydrogenase OS=Brassica campestris PE=2 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 3.382e-53
Identity = 99/159 (62.26%), Postives = 128/159 (80.50%), Query Frame = 2
Query:   11 KLRISPTILLDVPRDSLIMSEEIFGPLLPIIMVDRIEESFEVINSGTKPLAAYIFTNNKNLKEQFVKTISAGGLVINDTTIHLAVHTLPFGGVGDSGVGAYHGKFSFDAFSHKKAVLYRSFFGDASIRYPPYTKTKFRLMKALMTGSIVGIIRAIFGKS 487
            KL+ISPTIL+DVP +S +M EEIFGPLLP+I V +IE+ F+VI S  KPLAAY+FT+NK L+ +FV+ +SAGG+ IN+T +H+ +  LPFGGVG+SG+GAYHGKFS++ FSHKK VLYRSF GD+ +RYPPYT  K R++KAL++  I G I A FG S
Sbjct:  394 KLKISPTILVDVPEESSMMQEEIFGPLLPVITVSKIEDGFQVIRSKPKPLAAYLFTDNKVLQNRFVENVSAGGMGINETVLHVTLKDLPFGGVGESGIGAYHGKFSYETFSHKKGVLYRSFDGDSDLRYPPYTPEKKRVLKALLSSDIFGAILAFFGFS 552          
BLAST of AA430951 vs. SwissProt
Match: AL3H1_ARATH (Aldehyde dehydrogenase family 3 member H1 OS=Arabidopsis thaliana GN=ALDH3H1 PE=2 SV=2)

HSP 1 Score: 234.572 bits (597), Expect = 3.386e-61
Identity = 108/159 (67.92%), Postives = 136/159 (85.53%), Query Frame = 2
Query:    5 RPKLRISPTILLDVPRDSLIMSEEIFGPLLPIIMVDRIEESFEVINSGTKPLAAYIFTNNKNLKEQFVKTISAGGLVINDTTIHLAVHTLPFGGVGDSGVGAYHGKFSFDAFSHKKAVLYRSFFGDASIRYPPYTKTKFRLMKALMTGSIVGIIRAIFG 481
            R  L+I+PTILLDVP DSLIMSEEIFGPLLPI+ ++ +EESF+VI S  KPLAAY+FT+NK LKE+F  T+SAGG+V+ND  +HLA+HTLPFGGVG+SG+GAYHGKFSFDAFSHKKAVLYRS FGD+++RYPPY++ K RL+KAL+  +I  + + + G
Sbjct:  324 RENLKIAPTILLDVPLDSLIMSEEIFGPLLPILTLNNLEESFDVIRSRPKPLAAYLFTHNKKLKERFAATVSAGGIVVNDIAVHLALHTLPFGGVGESGMGAYHGKFSFDAFSHKKAVLYRSLFGDSAVRYPPYSRGKLRLLKALVDSNIFDLFKVLLG 482          
BLAST of AA430951 vs. SwissProt
Match: AL3I1_ARATH (Aldehyde dehydrogenase family 3 member I1, chloroplastic OS=Arabidopsis thaliana GN=ALDH3I1 PE=2 SV=2)

HSP 1 Score: 217.624 bits (553), Expect = 4.284e-56
Identity = 104/159 (65.41%), Postives = 127/159 (79.87%), Query Frame = 2
Query:   11 KLRISPTILLDVPRDSLIMSEEIFGPLLPIIMVDRIEESFEVINSGTKPLAAYIFTNNKNLKEQFVKTISAGGLVINDTTIHLAVHTLPFGGVGDSGVGAYHGKFSFDAFSHKKAVLYRSFFGDASIRYPPYTKTKFRLMKALMTGSIVGIIRAIFGKS 487
            KL+ISPTILLDVP  S +M EEIFGPLLPII V +IE+ F+VI S  KPLAAY+FTNNK L++QFV+ +SAGG+ INDT +H+ V  LPFGGVG+SG+GAYHGKFS++ FSHKK VLYRSF GDA +RYPPYT  K  ++KAL++ +I   I A FG S
Sbjct:  389 KLKISPTILLDVPEASSMMQEEIFGPLLPIITVQKIEDGFQVIRSKPKPLAAYLFTNNKELEKQFVQDVSAGGITINDTVLHVTVKDLPFGGVGESGIGAYHGKFSYETFSHKKGVLYRSFSGDADLRYPPYTPKKKMVLKALLSSNIFAAILAFFGFS 547          
BLAST of AA430951 vs. SwissProt
Match: ALDH_CRAPL (Aldehyde dehydrogenase OS=Craterostigma plantagineum GN=ALDH PE=1 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 1.577e-50
Identity = 95/161 (59.01%), Postives = 121/161 (75.16%), Query Frame = 2
Query:    5 RPKLRISPTILLDVPRDSLIMSEEIFGPLLPIIMVDRIEESFEVINSGTKPLAAYIFTNNKNLKEQFVKTISAGGLVINDTTIHLAVHTLPFGGVGDSGVGAYHGKFSFDAFSHKKAVLYRSFFGDASIRYPPYTKTKFRLMKALMTGSIVGIIRAIFGKS 487
            +  L+I+PTILLDV  DS +MSEEIFGPLLPII V +IEE +++I S  KPLAAY+FTN+K   E+FV  +SAGG+ IND  +H     LPFGGVG+SG+G+YHGKFSFDAFSHKK+VL RSF G+ + RYPPY   K   M+A++ G I G+++A  G S
Sbjct:  318 KSNLKIAPTILLDVSEDSSVMSEEIFGPLLPIITVGKIEECYKIIASKPKPLAAYLFTNDKKRTEEFVSNVSAGGITINDIALHFLEPRLPFGGVGESGMGSYHGKFSFDAFSHKKSVLKRSFGGEVAARYPPYAPWKLHFMEAILQGDIFGLLKAWLGWS 478          
BLAST of AA430951 vs. SwissProt
Match: AL3F1_ARATH (Aldehyde dehydrogenase family 3 member F1 OS=Arabidopsis thaliana GN=ALDH3F1 PE=1 SV=2)

HSP 1 Score: 154.066 bits (388), Expect = 5.816e-37
Identity = 76/157 (48.41%), Postives = 100/157 (63.69%), Query Frame = 2
Query:   11 KLRISPTILLDVPRDSLIMSEEIFGPLLPIIMVDRIEESFEVINSGTKPLAAYIFTNNKNLKEQFVKTISAGGLVINDTTIHLAVHTLPFGGVGDSGVGAYHGKFSFDAFSHKKAVLYRSFFGDASIRYPPYTKTKFRLMKALMTGSIVGIIRAIFG 481
            KL + PTILLD P DS IM+EEIFGP+LPII V  I+ES  +IN+  KPLA Y FTN++NLK + +   S+G +  ND  I      LPFGGVG+SG+G YHGK+SFD FSH+KA++  S   D   RYPP+   K   ++     +   +I  + G
Sbjct:  325 KLYVEPTILLDPPLDSEIMNEEIFGPILPIITVRDIQESIGIINTKPKPLAIYAFTNDENLKTRILSETSSGSVTFNDVMIQYMCDALPFGGVGESGIGRYHGKYSFDCFSHEKAIMEGSLGMDLEARYPPWNNFKLTFIRLAFREAYFKLILLMLG 481          
BLAST of AA430951 vs. SwissProt
Match: AL3A2_RAT (Fatty aldehyde dehydrogenase OS=Rattus norvegicus GN=Aldh3a2 PE=1 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 1.751e-33
Identity = 71/152 (46.71%), Postives = 101/152 (66.45%), Query Frame = 2
Query:   20 ISPTILLDVPRDSLIMSEEIFGPLLPIIMVDRIEESFEVINSGTKPLAAYIFTNNKNLKEQFVKTISAGGLVINDTTIHLAVHTLPFGGVGDSGVGAYHGKFSFDAFSHKKAVLYRSFFGDA--SIRYPPYTK-----TKFRLMKALMTGSI 454
            I+PTIL DV  +S +M EEIFGP+LPI+ V  +EE+   IN   KPLA YIF++N  L ++ +   S+GG+  ND  +H  V++LPFGGVG SG+GAYHGK+SFD FSH++  L +   G++   +RYPP ++     +KF L+K    G +
Sbjct:  313 IAPTILTDVDPNSKVMQEEIFGPILPIVSVKNVEEAINFINDREKPLALYIFSHNNKLIKRVIDETSSGGVTGNDVIMHFTVNSLPFGGVGASGMGAYHGKYSFDTFSHQRPCLLKGLKGESVNKLRYPPNSESKVSWSKFFLLKQFNKGRL 464          
BLAST of AA430951 vs. SwissProt
Match: AL3A2_MOUSE (Fatty aldehyde dehydrogenase OS=Mus musculus GN=Aldh3a2 PE=2 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 3.901e-33
Identity = 69/152 (45.39%), Postives = 101/152 (66.45%), Query Frame = 2
Query:   20 ISPTILLDVPRDSLIMSEEIFGPLLPIIMVDRIEESFEVINSGTKPLAAYIFTNNKNLKEQFVKTISAGGLVINDTTIHLAVHTLPFGGVGDSGVGAYHGKFSFDAFSHKKAVLYRSFFGDA--SIRYPPYTKT-----KFRLMKALMTGSI 454
            ++PTIL DV  +S +M EEIFGP+LPI+ V  ++E+   IN   KPLA Y+F+ N  L ++ +   S+GG+  ND  +H  V++LPFGGVG SG+GAYHGK+SFDAFSH++  L +   G++   +RYPP +++     KF L+K    G +
Sbjct:  313 LAPTILTDVDPNSKVMQEEIFGPILPIVSVKNVDEAINFINDREKPLALYVFSRNNKLIKRVIDETSSGGVTGNDVIMHFTVNSLPFGGVGASGMGAYHGKYSFDAFSHQRPCLLKGLKGESVNKLRYPPNSESKVSWAKFFLLKQFNKGRL 464          
BLAST of AA430951 vs. SwissProt
Match: AL3A1_RAT (Aldehyde dehydrogenase, dimeric NADP-preferring OS=Rattus norvegicus GN=Aldh3a1 PE=1 SV=3)

HSP 1 Score: 139.813 bits (351), Expect = 1.135e-32
Identity = 64/130 (49.23%), Postives = 93/130 (71.54%), Query Frame = 2
Query:   20 ISPTILLDVPRDSLIMSEEIFGPLLPIIMVDRIEESFEVINSGTKPLAAYIFTNNKNLKEQFVKTISAGGLVINDTTIHLAVHTLPFGGVGDSGVGAYHGKFSFDAFSHKKAVLYRSFFGDAS--IRYPP 403
            I+PTIL+DV   S +M EEIFGP++PI+ V  +EE+ + IN   KPLA Y+F+NN+ + ++ +   S+GG+  ND  +H+ V TLPFGGVG+SG+GAYHGK SF+ FSH+++ L +S   + +   RYPP
Sbjct:  316 IAPTILVDVDPQSPVMQEEIFGPVMPIVCVRSLEEAIQFINQREKPLALYVFSNNEKVIKKMIAETSSGGVTANDVIVHITVPTLPFGGVGNSGMGAYHGKKSFETFSHRRSCLVKSLLNEEAHKARYPP 445          
BLAST of AA430951 vs. SwissProt
Match: AL3A1_MOUSE (Aldehyde dehydrogenase, dimeric NADP-preferring OS=Mus musculus GN=Aldh3a1 PE=2 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 1.936e-32
Identity = 65/135 (48.15%), Postives = 94/135 (69.63%), Query Frame = 2
Query:    5 RPKLRISPTILLDVPRDSLIMSEEIFGPLLPIIMVDRIEESFEVINSGTKPLAAYIFTNNKNLKEQFVKTISAGGLVINDTTIHLAVHTLPFGGVGDSGVGAYHGKFSFDAFSHKKAVLYRSFFGDAS--IRYPP 403
            +P   I+PTIL+DV   S +M EEIFGP++PI+ V  ++E+ + IN   KPLA Y+F+NN  + ++ +   S+GG+  ND  +H+ V TLPFGGVG+SG+GAYHGK SF+ FSH+++ L RS   + +   RYPP
Sbjct:  311 QPSRYIAPTILVDVDPQSPVMQEEIFGPVMPIVCVRSLDEAIKFINQREKPLALYVFSNNDKVIKKMIAETSSGGVTANDVIVHITVPTLPFGGVGNSGMGAYHGKKSFETFSHRRSCLVRSLRNEEANKARYPP 445          
BLAST of AA430951 vs. SwissProt
Match: AL3A1_HUMAN (Aldehyde dehydrogenase, dimeric NADP-preferring OS=Homo sapiens GN=ALDH3A1 PE=1 SV=2)

HSP 1 Score: 138.272 bits (347), Expect = 3.303e-32
Identity = 63/130 (48.46%), Postives = 91/130 (70.00%), Query Frame = 2
Query:   20 ISPTILLDVPRDSLIMSEEIFGPLLPIIMVDRIEESFEVINSGTKPLAAYIFTNNKNLKEQFVKTISAGGLVINDTTIHLAVHTLPFGGVGDSGVGAYHGKFSFDAFSHKKAVLYRSFFGD--ASIRYPP 403
            I+PTIL DV   S +M EEIFGP+LPI+ V  +EE+ + IN   KPLA Y+F++N  + ++ +   S+GG+  ND  +H+ +H+LPFGGVG+SG+G+YHGK SF+ FSH+++ L R    D    +RYPP
Sbjct:  316 IAPTILTDVDPQSPVMQEEIFGPVLPIVCVRSLEEAIQFINQREKPLALYMFSSNDKVIKKMIAETSSGGVAANDVIVHITLHSLPFGGVGNSGMGSYHGKKSFETFSHRRSCLVRPLMNDEGLKVRYPP 445          
BLAST of AA430951 vs. SwissProt
Match: AL3A1_CANFA (Aldehyde dehydrogenase, dimeric NADP-preferring OS=Canis familiaris GN=ALDH3A1 PE=2 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 3.303e-32
Identity = 63/130 (48.46%), Postives = 92/130 (70.77%), Query Frame = 2
Query:   20 ISPTILLDVPRDSLIMSEEIFGPLLPIIMVDRIEESFEVINSGTKPLAAYIFTNNKNLKEQFVKTISAGGLVINDTTIHLAVHTLPFGGVGDSGVGAYHGKFSFDAFSHKKAVLYRSFFGDASI--RYPP 403
            I+PTIL+DV   S +M EEIFGP++PI+ V  +EE+ + IN   KPLA Y+F+ N  + ++ +   S+GG+  ND  +H++VH+LP+GGVG+SG+G+YHGK SF+ FSH ++ L R    D S+  RYPP
Sbjct:  316 IAPTILIDVDTQSQVMQEEIFGPVMPIVCVRSLEEAIQFINQREKPLALYVFSLNDKMIKKMIAETSSGGVTANDVIVHVSVHSLPYGGVGNSGMGSYHGKKSFETFSHCRSCLVRPLLNDESLKTRYPP 445          
BLAST of AA430951 vs. TAIR peptide
Match: AT1G44170.3 (| Symbols: ALDH3H1, ALDH4 | aldehyde dehydrogenase 3H1 | chr1:16796564-16798574 REVERSE LENGTH=421)

HSP 1 Score: 234.572 bits (597), Expect = 3.481e-62
Identity = 108/159 (67.92%), Postives = 136/159 (85.53%), Query Frame = 2
Query:    5 RPKLRISPTILLDVPRDSLIMSEEIFGPLLPIIMVDRIEESFEVINSGTKPLAAYIFTNNKNLKEQFVKTISAGGLVINDTTIHLAVHTLPFGGVGDSGVGAYHGKFSFDAFSHKKAVLYRSFFGDASIRYPPYTKTKFRLMKALMTGSIVGIIRAIFG 481
            R  L+I+PTILLDVP DSLIMSEEIFGPLLPI+ ++ +EESF+VI S  KPLAAY+FT+NK LKE+F  T+SAGG+V+ND  +HLA+HTLPFGGVG+SG+GAYHGKFSFDAFSHKKAVLYRS FGD+++RYPPY++ K RL+KAL+  +I  + + + G
Sbjct:  261 RENLKIAPTILLDVPLDSLIMSEEIFGPLLPILTLNNLEESFDVIRSRPKPLAAYLFTHNKKLKERFAATVSAGGIVVNDIAVHLALHTLPFGGVGESGMGAYHGKFSFDAFSHKKAVLYRSLFGDSAVRYPPYSRGKLRLLKALVDSNIFDLFKVLLG 419          
BLAST of AA430951 vs. TAIR peptide
Match: AT1G44170.2 (| Symbols: ALDH3H1, ALDH4 | aldehyde dehydrogenase 3H1 | chr1:16796564-16800031 REVERSE LENGTH=484)

HSP 1 Score: 234.572 bits (597), Expect = 3.481e-62
Identity = 108/159 (67.92%), Postives = 136/159 (85.53%), Query Frame = 2
Query:    5 RPKLRISPTILLDVPRDSLIMSEEIFGPLLPIIMVDRIEESFEVINSGTKPLAAYIFTNNKNLKEQFVKTISAGGLVINDTTIHLAVHTLPFGGVGDSGVGAYHGKFSFDAFSHKKAVLYRSFFGDASIRYPPYTKTKFRLMKALMTGSIVGIIRAIFG 481
            R  L+I+PTILLDVP DSLIMSEEIFGPLLPI+ ++ +EESF+VI S  KPLAAY+FT+NK LKE+F  T+SAGG+V+ND  +HLA+HTLPFGGVG+SG+GAYHGKFSFDAFSHKKAVLYRS FGD+++RYPPY++ K RL+KAL+  +I  + + + G
Sbjct:  324 RENLKIAPTILLDVPLDSLIMSEEIFGPLLPILTLNNLEESFDVIRSRPKPLAAYLFTHNKKLKERFAATVSAGGIVVNDIAVHLALHTLPFGGVGESGMGAYHGKFSFDAFSHKKAVLYRSLFGDSAVRYPPYSRGKLRLLKALVDSNIFDLFKVLLG 482          
BLAST of AA430951 vs. TAIR peptide
Match: AT1G44170.1 (| Symbols: ALDH3H1, ALDH4 | aldehyde dehydrogenase 3H1 | chr1:16796564-16800031 REVERSE LENGTH=484)

HSP 1 Score: 234.572 bits (597), Expect = 3.481e-62
Identity = 108/159 (67.92%), Postives = 136/159 (85.53%), Query Frame = 2
Query:    5 RPKLRISPTILLDVPRDSLIMSEEIFGPLLPIIMVDRIEESFEVINSGTKPLAAYIFTNNKNLKEQFVKTISAGGLVINDTTIHLAVHTLPFGGVGDSGVGAYHGKFSFDAFSHKKAVLYRSFFGDASIRYPPYTKTKFRLMKALMTGSIVGIIRAIFG 481
            R  L+I+PTILLDVP DSLIMSEEIFGPLLPI+ ++ +EESF+VI S  KPLAAY+FT+NK LKE+F  T+SAGG+V+ND  +HLA+HTLPFGGVG+SG+GAYHGKFSFDAFSHKKAVLYRS FGD+++RYPPY++ K RL+KAL+  +I  + + + G
Sbjct:  324 RENLKIAPTILLDVPLDSLIMSEEIFGPLLPILTLNNLEESFDVIRSRPKPLAAYLFTHNKKLKERFAATVSAGGIVVNDIAVHLALHTLPFGGVGESGMGAYHGKFSFDAFSHKKAVLYRSLFGDSAVRYPPYSRGKLRLLKALVDSNIFDLFKVLLG 482          
BLAST of AA430951 vs. TAIR peptide
Match: AT4G34240.1 (| Symbols: ALDH3I1, ALDH3 | aldehyde dehydrogenase 3I1 | chr4:16389801-16392633 FORWARD LENGTH=550)

HSP 1 Score: 217.624 bits (553), Expect = 4.403e-57
Identity = 104/159 (65.41%), Postives = 127/159 (79.87%), Query Frame = 2
Query:   11 KLRISPTILLDVPRDSLIMSEEIFGPLLPIIMVDRIEESFEVINSGTKPLAAYIFTNNKNLKEQFVKTISAGGLVINDTTIHLAVHTLPFGGVGDSGVGAYHGKFSFDAFSHKKAVLYRSFFGDASIRYPPYTKTKFRLMKALMTGSIVGIIRAIFGKS 487
            KL+ISPTILLDVP  S +M EEIFGPLLPII V +IE+ F+VI S  KPLAAY+FTNNK L++QFV+ +SAGG+ INDT +H+ V  LPFGGVG+SG+GAYHGKFS++ FSHKK VLYRSF GDA +RYPPYT  K  ++KAL++ +I   I A FG S
Sbjct:  389 KLKISPTILLDVPEASSMMQEEIFGPLLPIITVQKIEDGFQVIRSKPKPLAAYLFTNNKELEKQFVQDVSAGGITINDTVLHVTVKDLPFGGVGESGIGAYHGKFSYETFSHKKGVLYRSFSGDADLRYPPYTPKKKMVLKALLSSNIFAAILAFFGFS 547          
BLAST of AA430951 vs. TAIR peptide
Match: AT4G36250.1 (| Symbols: ALDH3F1 | aldehyde dehydrogenase 3F1 | chr4:17151029-17153381 FORWARD LENGTH=484)

HSP 1 Score: 154.066 bits (388), Expect = 5.979e-38
Identity = 76/157 (48.41%), Postives = 100/157 (63.69%), Query Frame = 2
Query:   11 KLRISPTILLDVPRDSLIMSEEIFGPLLPIIMVDRIEESFEVINSGTKPLAAYIFTNNKNLKEQFVKTISAGGLVINDTTIHLAVHTLPFGGVGDSGVGAYHGKFSFDAFSHKKAVLYRSFFGDASIRYPPYTKTKFRLMKALMTGSIVGIIRAIFG 481
            KL + PTILLD P DS IM+EEIFGP+LPII V  I+ES  +IN+  KPLA Y FTN++NLK + +   S+G +  ND  I      LPFGGVG+SG+G YHGK+SFD FSH+KA++  S   D   RYPP+   K   ++     +   +I  + G
Sbjct:  325 KLYVEPTILLDPPLDSEIMNEEIFGPILPIITVRDIQESIGIINTKPKPLAIYAFTNDENLKTRILSETSSGSVTFNDVMIQYMCDALPFGGVGESGIGRYHGKYSFDCFSHEKAIMEGSLGMDLEARYPPWNNFKLTFIRLAFREAYFKLILLMLG 481          
BLAST of AA430951 vs. TAIR peptide
Match: AT3G66658.2 (| Symbols: ALDH22A1 | aldehyde dehydrogenase 22A1 | chr3:2095341-2099013 REVERSE LENGTH=596)

HSP 1 Score: 75.485 bits (184), Expect = 2.702e-14
Identity = 45/144 (31.25%), Postives = 69/144 (47.92%), Query Frame = 2
Query:   26 PTILLDVPRDSLIMSEEIFGPLLPIIMVDRIEESFEVINSGTKPLAAYIFTNNKNLKEQFVKTISAGGLVINDTTIHLAVHTLPFGGVGDSGVGAYHGKFSFDAFSHKKAVLYRSFFGDASIRYP-----PYTKTKFRLMKALM 442
            PT+L++V  +  IM EE FGP++PI+     EE  ++ N     L   +F+ +K+  +Q    I  G   IND   +    +LPFGGV DSG G + G     A    K+V+   F+     + P     P  +  F   +AL+
Sbjct:  417 PTVLINVNHNMKIMKEEAFGPIMPIMQFSTDEEVIKLANDSRYALGCAVFSGSKHRAKQIASQIQCGVAAINDFASNYMCQSLPFGGVKDSGFGRFAGIEGLRACCLVKSVVEDRFWPLIKTKIPKPIQYPVAENAFEFQEALV 560          
BLAST of AA430951 vs. TAIR peptide
Match: AT3G66658.1 (| Symbols: ALDH22A1 | aldehyde dehydrogenase 22A1 | chr3:2095471-2099013 REVERSE LENGTH=554)

HSP 1 Score: 73.9442 bits (180), Expect = 7.863e-14
Identity = 46/142 (32.39%), Postives = 68/142 (47.89%), Query Frame = 2
Query:   26 PTILLDVPRDSLIMSEEIFGPLLPIIMVDRIEESFEVINSGTKPLAAYIFTNNKNLKEQFVKTISAGGLVINDTTIHLAVHTLPFGGVGDSGVGAYHGKFSFDAFSHKKAVLYRSFFGDASIRYPPYTKTKFRLMKALMTGS 451
            PT+L++V  +  IM EE FGP++PI+     EE  ++ N     L   +F+ +K+  +Q    I  G   IND   +    +LPFGGV DSG G + G     A    K+V+   F+        P  KTK       ++GS
Sbjct:  417 PTVLINVNHNMKIMKEEAFGPIMPIMQFSTDEEVIKLANDSRYALGCAVFSGSKHRAKQIASQIQCGVAAINDFASNYMCQSLPFGGVKDSGFGRFAGIEGLRACCLVKSVVEDRFW--------PLIKTKIPKPIQAISGS 550          
BLAST of AA430951 vs. TAIR peptide
Match: AT1G79440.1 (| Symbols: ALDH5F1, SSADH1, SSADH | aldehyde dehydrogenase 5F1 | chr1:29882525-29887275 REVERSE LENGTH=528)

HSP 1 Score: 67.3958 bits (163), Expect = 7.359e-12
Identity = 37/111 (33.33%), Postives = 58/111 (52.25%), Query Frame = 2
Query:   26 PTILLDVPRDSLIMSEEIFGPLLPIIMVDRIEESFEVINSGTKPLAAYIFTNNKNLKEQFVKTISAGGLVINDTTIHLAVHTLPFGGVGDSGVGAYHGKFSFDAFSHKKAV 358
            PT++ DV  + ++  EEIFGP+ P+I     E++  + N     LAAYIFTN+     +  + +  G + +N+  I  +    PFGGV  SG+G    K+  D +   K V
Sbjct:  412 PTVIRDVSDNMIMSKEEIFGPVAPLIRFKTEEDAIRIANDTIAGLAAYIFTNSVQRSWRVFEALEYGLVGVNEGLI--STEVAPFGGVKQSGLGREGSKYGMDEYLEIKYV 520          
BLAST of AA430951 vs. TAIR peptide
Match: AT1G23800.1 (| Symbols: ALDH2B7, ALDH2B | aldehyde dehydrogenase 2B7 | chr1:8412238-8414804 REVERSE LENGTH=534)

HSP 1 Score: 63.5438 bits (153), Expect = 1.063e-10
Identity = 38/114 (33.33%), Postives = 61/114 (53.51%), Query Frame = 2
Query:   20 ISPTILLDVPRDSLIMSEEIFGPLLPIIMVDRIEESFEVINSGTKPLAAYIFTNNKNLKEQFVKTISAGGLVINDTTIHLAVHTLPFGGVGDSGVGAYHGKFSFDAFSHKKAVL 361
            I PT+  DV  D LI ++EIFGP+  I+    ++E     N+    LAA +FT N +   + ++ +  G + IN   +  A  ++PFGG   SG+G   G +S + +   KAV+
Sbjct:  414 IQPTVFSDVKDDMLIATDEIFGPVQTILKFKDLDEVIARANNSRYGLAAGVFTQNLDTAHRLMRALRVGTVWINCFDVLDA--SIPFGGYKMSGIGREKGIYSLNNYLQVKAVV 525          
BLAST of AA430951 vs. TAIR peptide
Match: AT3G48000.1 (| Symbols: ALDH2B4, ALDH2, ALDH2A | aldehyde dehydrogenase 2B4 | chr3:17717082-17719843 REVERSE LENGTH=538)

HSP 1 Score: 59.3066 bits (142), Expect = 2.004e-9
Identity = 37/114 (32.46%), Postives = 58/114 (50.88%), Query Frame = 2
Query:   20 ISPTILLDVPRDSLIMSEEIFGPLLPIIMVDRIEESFEVINSGTKPLAAYIFTNNKNLKEQFVKTISAGGLVINDTTIHLAVHTLPFGGVGDSGVGAYHGKFSFDAFSHKKAVL 361
            I PT+  +V  D LI  +EIFGP+  I+    ++E  +  N     LAA +FT N +   +  + + AG + +N   +  A   +PFGG   SG G   G +S + +   KAV+
Sbjct:  418 IQPTVFSNVKDDMLIAQDEIFGPVQSILKFSDVDEVIKRANETKYGLAAGVFTKNLDTANRVSRALKAGTVWVNCFDVFDA--AIPFGGYKMSGNGREKGIYSLNNYLQIKAVV 529          
The following BLAST results are available for this feature:
BLAST of AA430951 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
B7FM69_MEDTR1.011e-7385.09Putative uncharacterized protein OS=Medicago trunc... [more]
B9S2Y3_RICCO9.168e-6778.85Aldehyde dehydrogenase, putative OS=Ricinus commun... [more]
B9GU23_POPTR1.014e-6575.32Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
B9H7G3_POPTR1.239e-6372.78Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
D7KVK7_ARALY1.675e-6068.32ALDH3H1 OS=Arabidopsis lyrata subsp. lyrata GN=ARA... [more]
A8MQF0_ARATH4.873e-6067.92Uncharacterized protein At1g44170.3 OS=Arabidopsis... [more]
D7SWG5_VITVI1.622e-5564.78Whole genome shotgun sequence of line PN40024, sca... [more]
A5AQ13_VITVI1.622e-5564.78Putative uncharacterized protein OS=Vitis vinifera... [more]
B9H4N6_POPTR1.793e-5462.89Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
Q2PQL8_BRACM3.382e-5362.26Putative aldehyde dehydrogenase OS=Brassica campes... [more]
back to top
BLAST of AA430951 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Swissprot)
Total hits: 10
Match NameE-valueIdentityDescription
AL3H1_ARATH3.386e-6167.92Aldehyde dehydrogenase family 3 member H1 OS=Arabi... [more]
AL3I1_ARATH4.284e-5665.41Aldehyde dehydrogenase family 3 member I1, chlorop... [more]
ALDH_CRAPL1.577e-5059.01Aldehyde dehydrogenase OS=Craterostigma plantagine... [more]
AL3F1_ARATH5.816e-3748.41Aldehyde dehydrogenase family 3 member F1 OS=Arabi... [more]
AL3A2_RAT1.751e-3346.71Fatty aldehyde dehydrogenase OS=Rattus norvegicus ... [more]
AL3A2_MOUSE3.901e-3345.39Fatty aldehyde dehydrogenase OS=Mus musculus GN=Al... [more]
AL3A1_RAT1.135e-3249.23Aldehyde dehydrogenase, dimeric NADP-preferring OS... [more]
AL3A1_MOUSE1.936e-3248.15Aldehyde dehydrogenase, dimeric NADP-preferring OS... [more]
AL3A1_HUMAN3.303e-3248.46Aldehyde dehydrogenase, dimeric NADP-preferring OS... [more]
AL3A1_CANFA3.303e-3248.46Aldehyde dehydrogenase, dimeric NADP-preferring OS... [more]
back to top
BLAST of AA430951 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide)
Total hits: 10
Match NameE-valueIdentityDescription
AT1G44170.33.481e-6267.92| Symbols: ALDH3H1, ALDH4 | aldehyde dehydrogenase... [more]
AT1G44170.23.481e-6267.92| Symbols: ALDH3H1, ALDH4 | aldehyde dehydrogenase... [more]
AT1G44170.13.481e-6267.92| Symbols: ALDH3H1, ALDH4 | aldehyde dehydrogenase... [more]
AT4G34240.14.403e-5765.41| Symbols: ALDH3I1, ALDH3 | aldehyde dehydrogenase... [more]
AT4G36250.15.979e-3848.41| Symbols: ALDH3F1 | aldehyde dehydrogenase 3F1 | ... [more]
AT3G66658.22.702e-1431.25| Symbols: ALDH22A1 | aldehyde dehydrogenase 22A1 ... [more]
AT3G66658.17.863e-1432.39| Symbols: ALDH22A1 | aldehyde dehydrogenase 22A1 ... [more]
AT1G79440.17.359e-1233.33| Symbols: ALDH5F1, SSADH1, SSADH | aldehyde dehyd... [more]
AT1G23800.11.063e-1033.33| Symbols: ALDH2B7, ALDH2B | aldehyde dehydrogenas... [more]
AT3G48000.12.004e-932.46| Symbols: ALDH2B4, ALDH2, ALDH2A | aldehyde dehyd... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR012394Aldehyde dehydrogenase NAD(P)-dependentPANTHERPTHR11699:SF15ALDEHYDE DEHYDROGENASEcoord: 2..161
score: 8.3
IPR015590Aldehyde dehydrogenase domainPANTHERPTHR11699ALDEHYDE DEHYDROGENASE-RELATEDcoord: 2..161
score: 8.3
IPR015590Aldehyde dehydrogenase domainPFAMPF00171Aldedhcoord: 7..119
score: 1.7
IPR016161Aldehyde/histidinol dehydrogenaseSUPERFAMILY53720ALDH-likecoord: 7..122
score: 2.5
IPR016163Aldehyde dehydrogenase, C-terminalGENE3D3.40.309.10no descriptioncoord: 6..99
score: 2.2
NoneNo IPR availableSEGsegsegcoord: 43..54
score

Properties
Property NameValue
Singlet in analysisPisum sativum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>AA430951 ID=AA430951|Name=AA430951|organism=Pisum sativum|type=EST|length=638bp
GGCACGACCCAAATTGAGAATTAGCCCTACTATTCTATTGGATGTCCCGC
GAGATTCTCTGATAATGAGTGAAGAGATATTTGGTCCTTTACTTCCCATC
ATTATGGTGGATAGAATAGAAGAAAGCTTTGAAGTGATAAATTCAGGAAC
AAAGCCTCTTGCTGCATATATATTTACCAACAATAAGAATCTCAAGGAGC
AGTTTGTTAAGACGATTTCCGCTGGTGGTTTGGTCATCAATGACACTACT
ATACACCTTGCAGTTCATACTCTACCTTTTGGAGGAGTAGGTGACAGTGG
AGTTGGTGCATACCATGGAAAATTCTCTTTTGATGCATTTAGCCACAAAA
AAGCAGTTCTTTATCGCAGTTTTTTTGGTGATGCTTCTATAAGGTATCCA
CCATACACCAAAACAAAGTTTAGATTGATGAAGGCTCTCATGACTGGTAG
CATAGTTGGTATAATTCGTGCTATATTTGGAAAGTCCTAGAATTATGTGT
CTTGGAATCTAGCATTTAATTGTATTTGGCAAGTCTTTTATTTTGGTNNC
CTTGTATTTTATTGTTCATTTTTTGTTGGTTTAAACACATCAACCATGAC
TTTTGTGTTTGAGAATAAATTGGATAGTTCTATATGCT
back to top
Annotated Terms
The following terms have been associated with this EST:
Vocabulary: Molecular Function
TermDefinition
GO:0004030aldehyde dehydrogenase [NAD(P)+] activity
GO:0016491oxidoreductase activity
Vocabulary: Biological Process
TermDefinition
GO:0006081cellular aldehyde metabolic process
GO:0055114oxidation-reduction process
GO:0008152metabolic process
Vocabulary: INTERPRO
TermDefinition
IPR012394Aldehyde_DH_NAD(P)
IPR015590Aldehyde_DH_dom
IPR016161Ald_DH/histidinol_DH
IPR016163Ald_DH_C