U74095

EST Overview
NameU74095
Unique NameU74095
TypeEST
OrganismPisum sativum (pea)
Sequence length313
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
Pisum sativum unigene v12010-12-27
Homology Analysis: Pisum sativum unigene v1 vs Trembl2010-12-28
Pisum sativum unigene v22011-03-01
Homology Analysis: Pisum sativum unigene v2 vs Trembl2011-04-27
Homology Analysis: Pisum sativum unigene v2 vs Soybean peptides2011-04-21
Libraries
Library NameType
LIBEST_000542 Pisum sativum (J.S.Day)cdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Pisum sativum unigene v2Pisum sativum unigene v2EST
Pisum sativum unigene v1Pisum sativum unigene v1EST
Homology
BLAST of U74095 vs. TrEMBL
Match: O65147_SOYBN (Gag-pol polyprotein OS=Glycine max GN=pol PE=4 SV=2)

HSP 1 Score: 95.9005 bits (237), Expect = 1.399e-18
Identity = 50/98 (51.02%), Postives = 65/98 (66.33%), Query Frame = -1
Query:   17 GHIKAFYYWFIGFPNKPCMSGLSIKHISAMXXLRNNNGMLG*HTLLRASSREDWYLDSGCSRHXTGMENLLVDIQPHTTSYVTFGDGAKEKIKGVGXM 310
            GHIK F Y   G P+    S  S + +  M   ++    L  HT LRAS++EDWYLDSGCSRH TG++  LV+I+P +TSYVTFGDG+K KI G+G +
Sbjct:  485 GHIKPFCYHLHGHPHHGTQSSSSGRKM--MWVPKHKTVSLVVHTSLRASAKEDWYLDSGCSRHMTGVKEFLVNIEPCSTSYVTFGDGSKGKITGMGKL 580          
BLAST of U74095 vs. TrEMBL
Match: Q84VI0_SOYBN (Gag-pol polyprotein OS=Glycine max GN=gag-pol PE=4 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 3.116e-18
Identity = 50/98 (51.02%), Postives = 65/98 (66.33%), Query Frame = -1
Query:   17 GHIKAFYYWFIGFPNKPCMSGLSIKHISAMXXLRNNNGMLG*HTLLRASSREDWYLDSGCSRHXTGMENLLVDIQPHTTSYVTFGDGAKEKIKGVGXM 310
            GHIK F Y   G P+    S  S + +  M   ++    L  HT LRAS++EDWYLDSGCSRH TG++  LV+I+P +TSYVTFGDG+K KI G+G +
Sbjct:  511 GHIKPFCYHLHGHPHHGTQSSSSGRKM--MWVPKHKIVSLVVHTSLRASAKEDWYLDSGCSRHMTGVKEFLVNIEPCSTSYVTFGDGSKGKITGMGKL 606          
BLAST of U74095 vs. TrEMBL
Match: Q84VI2_SOYBN (Gag-pol polyprotein OS=Glycine max GN=gag-pol PE=4 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 4.070e-18
Identity = 50/98 (51.02%), Postives = 65/98 (66.33%), Query Frame = -1
Query:   17 GHIKAFYYWFIGFPNKPCMSGLSIKHISAMXXLRNNNGMLG*HTLLRASSREDWYLDSGCSRHXTGMENLLVDIQPHTTSYVTFGDGAKEKIKGVGXM 310
            GHIK F Y   G P+    S  S K +  M   ++    L  HT LRAS++EDWYLDSGCSRH TG++  L++I+P +TSYVTFGDG+K KI G+G +
Sbjct:  511 GHIKPFCYHLHGHPHHGTQSSNSRKKM--MWVPKHKAVSLVVHTSLRASAKEDWYLDSGCSRHMTGVKEFLLNIEPCSTSYVTFGDGSKGKIIGMGKL 606          
BLAST of U74095 vs. TrEMBL
Match: Q84VH8_SOYBN (Gag-pol polyprotein OS=Glycine max GN=gag-pol PE=4 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 4.070e-18
Identity = 50/98 (51.02%), Postives = 65/98 (66.33%), Query Frame = -1
Query:   17 GHIKAFYYWFIGFPNKPCMSGLSIKHISAMXXLRNNNGMLG*HTLLRASSREDWYLDSGCSRHXTGMENLLVDIQPHTTSYVTFGDGAKEKIKGVGXM 310
            GHIK F Y   G P+    S  S K +  M   ++    L  HT LRAS++EDWYLDSGCSRH TG++  L++I+P +TSYVTFGDG+K KI G+G +
Sbjct:  511 GHIKPFCYHLHGHPHHGTQSSNSRKKM--MWVPKHKAVSLVVHTSLRASAKEDWYLDSGCSRHMTGVKEFLLNIEPCSTSYVTFGDGSKGKIIGMGKL 606          
BLAST of U74095 vs. TrEMBL
Match: Q84VH6_SOYBN (Gag-pol polyprotein OS=Glycine max GN=gag-pol PE=4 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 9.066e-18
Identity = 49/98 (50.00%), Postives = 64/98 (65.31%), Query Frame = -1
Query:   17 GHIKAFYYWFIGFPNKPCMSGLSIKHISAMXXLRNNNGMLG*HTLLRASSREDWYLDSGCSRHXTGMENLLVDIQPHTTSYVTFGDGAKEKIKGVGXM 310
            GHIK F Y   G P+       S + +  M   ++    L  HT LRAS++EDWYLDSGCSRH TG++  LV+I+P +TSYVTFGDG+K KI G+G +
Sbjct:  512 GHIKPFCYHLHGHPHHGTQGSSSGRKM--MWVPKHKIVSLVVHTSLRASAKEDWYLDSGCSRHMTGVKEFLVNIEPCSTSYVTFGDGSKGKITGMGKL 607          
BLAST of U74095 vs. TrEMBL
Match: Q84VI4_SOYBN (Gag-pol polyprotein OS=Glycine max GN=gag-pol PE=4 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 2.916e-16
Identity = 49/98 (50.00%), Postives = 64/98 (65.31%), Query Frame = -1
Query:   17 GHIKAFYYWFIGFPNKPCMSGLSIKHISAMXXLRNNNGMLG*HTLLRASSREDWYLDSGCSRHXTGMENLLVDIQPHTTSYVTFGDGAKEKIKGVGXM 310
            GHIK F Y     P+    S  S K +  M   ++    L  HT LRAS++EDWYLDSGCSRH TG++  L++I+P +TSYVTFGDG+K KI G+G +
Sbjct:  511 GHIKPFCYHL--HPHHGTQSSNSRKKM--MWVPKHKAVSLVVHTSLRASAKEDWYLDSGCSRHMTGVKEFLLNIEPCSTSYVTFGDGSKGKIIGMGKL 604          
BLAST of U74095 vs. TrEMBL
Match: A2Q2L9_MEDTR (Gag-pol polyprotein, related OS=Medicago truncatula GN=MtrDRAFT_AC151520g36v2 PE=4 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 6.081e-14
Identity = 34/56 (60.71%), Postives = 46/56 (82.14%), Query Frame = -1
Query:   17 HTLLRASSREDWYLDSGCSRHXTGMENLLVDIQPHTTSYVTFGDGAKEKIKGVGXM 184
            HT LRA+S+EDWY DSGCSRH +G++  L +++P+T+SYVTF DGAK KI G+G +
Sbjct:  262 HTSLRATSKEDWYFDSGCSRHMSGVDKYLENVRPYTSSYVTFVDGAKGKIVGIGNL 317          
BLAST of U74095 vs. TrEMBL
Match: Q9SKW9_ARATH (F5J5.1 OS=Arabidopsis thaliana PE=4 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 4.221e-7
Identity = 25/60 (41.67%), Postives = 36/60 (60.00%), Query Frame = -1
Query:    5 HTLLRASSREDWYLDSGCSRHXTGMENLLVDIQPHTTSYVTFGDGAKEKIKGVGXMDCSE 184
            +T + + +   WY DSGCSRH TG++++L D        VTFGDG K  IKG G ++  +
Sbjct:  552 YTSVVSQNNRAWYFDSGCSRHMTGVQSILKDFSVINNGKVTFGDGGKGSIKGKGKIEIDD 611          
BLAST of U74095 vs. TrEMBL
Match: O65147_SOYBN (Gag-pol polyprotein OS=Glycine max GN=pol PE=4 SV=2)

HSP 1 Score: 95.9005 bits (237), Expect = 1.749e-18
Identity = 50/98 (51.02%), Postives = 65/98 (66.33%), Query Frame = -1
Query:   17 GHIKAFYYWFIGFPNKPCMSGLSIKHISAMXXLRNNNGMLG*HTLLRASSREDWYLDSGCSRHXTGMENLLVDIQPHTTSYVTFGDGAKEKIKGVGXM 310
            GHIK F Y   G P+    S  S + +  M   ++    L  HT LRAS++EDWYLDSGCSRH TG++  LV+I+P +TSYVTFGDG+K KI G+G +
Sbjct:  485 GHIKPFCYHLHGHPHHGTQSSSSGRKM--MWVPKHKTVSLVVHTSLRASAKEDWYLDSGCSRHMTGVKEFLVNIEPCSTSYVTFGDGSKGKITGMGKL 580          
BLAST of U74095 vs. TrEMBL
Match: Q84VI0_SOYBN (Gag-pol polyprotein OS=Glycine max GN=gag-pol PE=4 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 3.897e-18
Identity = 50/98 (51.02%), Postives = 65/98 (66.33%), Query Frame = -1
Query:   17 GHIKAFYYWFIGFPNKPCMSGLSIKHISAMXXLRNNNGMLG*HTLLRASSREDWYLDSGCSRHXTGMENLLVDIQPHTTSYVTFGDGAKEKIKGVGXM 310
            GHIK F Y   G P+    S  S + +  M   ++    L  HT LRAS++EDWYLDSGCSRH TG++  LV+I+P +TSYVTFGDG+K KI G+G +
Sbjct:  511 GHIKPFCYHLHGHPHHGTQSSSSGRKM--MWVPKHKIVSLVVHTSLRASAKEDWYLDSGCSRHMTGVKEFLVNIEPCSTSYVTFGDGSKGKITGMGKL 606          
BLAST of U74095 vs. TrEMBL
Match: Q84VI2_SOYBN (Gag-pol polyprotein OS=Glycine max GN=gag-pol PE=4 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 5.089e-18
Identity = 50/98 (51.02%), Postives = 65/98 (66.33%), Query Frame = -1
Query:   17 GHIKAFYYWFIGFPNKPCMSGLSIKHISAMXXLRNNNGMLG*HTLLRASSREDWYLDSGCSRHXTGMENLLVDIQPHTTSYVTFGDGAKEKIKGVGXM 310
            GHIK F Y   G P+    S  S K +  M   ++    L  HT LRAS++EDWYLDSGCSRH TG++  L++I+P +TSYVTFGDG+K KI G+G +
Sbjct:  511 GHIKPFCYHLHGHPHHGTQSSNSRKKM--MWVPKHKAVSLVVHTSLRASAKEDWYLDSGCSRHMTGVKEFLLNIEPCSTSYVTFGDGSKGKIIGMGKL 606          
BLAST of U74095 vs. TrEMBL
Match: Q84VH8_SOYBN (Gag-pol polyprotein OS=Glycine max GN=gag-pol PE=4 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 5.089e-18
Identity = 50/98 (51.02%), Postives = 65/98 (66.33%), Query Frame = -1
Query:   17 GHIKAFYYWFIGFPNKPCMSGLSIKHISAMXXLRNNNGMLG*HTLLRASSREDWYLDSGCSRHXTGMENLLVDIQPHTTSYVTFGDGAKEKIKGVGXM 310
            GHIK F Y   G P+    S  S K +  M   ++    L  HT LRAS++EDWYLDSGCSRH TG++  L++I+P +TSYVTFGDG+K KI G+G +
Sbjct:  511 GHIKPFCYHLHGHPHHGTQSSNSRKKM--MWVPKHKAVSLVVHTSLRASAKEDWYLDSGCSRHMTGVKEFLLNIEPCSTSYVTFGDGSKGKIIGMGKL 606          
BLAST of U74095 vs. TrEMBL
Match: Q84VH6_SOYBN (Gag-pol polyprotein OS=Glycine max GN=gag-pol PE=4 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.134e-17
Identity = 49/98 (50.00%), Postives = 64/98 (65.31%), Query Frame = -1
Query:   17 GHIKAFYYWFIGFPNKPCMSGLSIKHISAMXXLRNNNGMLG*HTLLRASSREDWYLDSGCSRHXTGMENLLVDIQPHTTSYVTFGDGAKEKIKGVGXM 310
            GHIK F Y   G P+       S + +  M   ++    L  HT LRAS++EDWYLDSGCSRH TG++  LV+I+P +TSYVTFGDG+K KI G+G +
Sbjct:  512 GHIKPFCYHLHGHPHHGTQGSSSGRKM--MWVPKHKIVSLVVHTSLRASAKEDWYLDSGCSRHMTGVKEFLVNIEPCSTSYVTFGDGSKGKITGMGKL 607          
BLAST of U74095 vs. TrEMBL
Match: Q84VI4_SOYBN (Gag-pol polyprotein OS=Glycine max GN=gag-pol PE=4 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 3.647e-16
Identity = 49/98 (50.00%), Postives = 64/98 (65.31%), Query Frame = -1
Query:   17 GHIKAFYYWFIGFPNKPCMSGLSIKHISAMXXLRNNNGMLG*HTLLRASSREDWYLDSGCSRHXTGMENLLVDIQPHTTSYVTFGDGAKEKIKGVGXM 310
            GHIK F Y     P+    S  S K +  M   ++    L  HT LRAS++EDWYLDSGCSRH TG++  L++I+P +TSYVTFGDG+K KI G+G +
Sbjct:  511 GHIKPFCYHL--HPHHGTQSSNSRKKM--MWVPKHKAVSLVVHTSLRASAKEDWYLDSGCSRHMTGVKEFLLNIEPCSTSYVTFGDGSKGKIIGMGKL 604          
BLAST of U74095 vs. TrEMBL
Match: A2Q2L9_MEDTR (Gag-pol polyprotein, related OS=Medicago truncatula GN=MtrDRAFT_AC151520g36v2 PE=4 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 7.605e-14
Identity = 34/56 (60.71%), Postives = 46/56 (82.14%), Query Frame = -1
Query:   17 HTLLRASSREDWYLDSGCSRHXTGMENLLVDIQPHTTSYVTFGDGAKEKIKGVGXM 184
            HT LRA+S+EDWY DSGCSRH +G++  L +++P+T+SYVTF DGAK KI G+G +
Sbjct:  262 HTSLRATSKEDWYFDSGCSRHMSGVDKYLENVRPYTSSYVTFVDGAKGKIVGIGNL 317          
BLAST of U74095 vs. TrEMBL
Match: Q9SKW9_ARATH (F5J5.1 OS=Arabidopsis thaliana PE=4 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 5.279e-7
Identity = 25/60 (41.67%), Postives = 36/60 (60.00%), Query Frame = -1
Query:    5 HTLLRASSREDWYLDSGCSRHXTGMENLLVDIQPHTTSYVTFGDGAKEKIKGVGXMDCSE 184
            +T + + +   WY DSGCSRH TG++++L D        VTFGDG K  IKG G ++  +
Sbjct:  552 YTSVVSQNNRAWYFDSGCSRHMTGVQSILKDFSVINNGKVTFGDGGKGSIKGKGKIEIDD 611          
BLAST of U74095 vs. Soybean peptides
Match: Glyma10g22170.1|PACid:16279754 ()

HSP 1 Score: 95.5153 bits (236), Expect = 1.094e-20
Identity = 51/98 (52.04%), Postives = 65/98 (66.33%), Query Frame = -1
Query:   17 GHIKAFYYWFIGFPNKPCMSGLSIKHISAMXXLRNNNGMLG*HTLLRASSREDWYLDSGCSRHXTGMENLLVDIQPHTTSYVTFGDGAKEKIKGVGXM 310
            GHIK F Y   G P+    S  S K +  M   ++    L  HT LRAS++EDWYLDSGCSRH TG++  LV+I+P +TSYVTFGDG+K KI G+G +
Sbjct:  511 GHIKPFCYHLHGHPHHGTQSSNSRKKM--MWVPKHKAVSLVVHTSLRASAKEDWYLDSGCSRHMTGVKEFLVNIEPCSTSYVTFGDGSKGKIIGMGRL 606          
BLAST of U74095 vs. Soybean peptides
Match: Glyma15g32290.1|PACid:16300007 ()

HSP 1 Score: 95.1301 bits (235), Expect = 1.429e-20
Identity = 50/98 (51.02%), Postives = 65/98 (66.33%), Query Frame = -1
Query:   17 GHIKAFYYWFIGFPNKPCMSGLSIKHISAMXXLRNNNGMLG*HTLLRASSREDWYLDSGCSRHXTGMENLLVDIQPHTTSYVTFGDGAKEKIKGVGXM 310
            GHIK F Y   G P+    S  S + +  M   ++    L  HT LRAS++EDWYLDSGCSRH TG++  LV+I+P +TSYVTFGDG+K KI G+G +
Sbjct:  512 GHIKPFCYHLHGHPHHGTQSSSSGRKM--MWVPKHKTVSLVVHTSLRASAKEDWYLDSGCSRHMTGVKEFLVNIEPCSTSYVTFGDGSKGKIIGMGKL 607          
BLAST of U74095 vs. Soybean peptides
Match: Glyma09g26090.1|PACid:16276273 ()

HSP 1 Score: 94.7449 bits (234), Expect = 1.866e-20
Identity = 50/98 (51.02%), Postives = 65/98 (66.33%), Query Frame = -1
Query:   17 GHIKAFYYWFIGFPNKPCMSGLSIKHISAMXXLRNNNGMLG*HTLLRASSREDWYLDSGCSRHXTGMENLLVDIQPHTTSYVTFGDGAKEKIKGVGXM 310
            GHIK F Y   G P+    S  S + +  M   ++    L  HT LRAS++EDWYLDSGCSRH TG++  LV+I+P +TSYVTFGDG+K KI G+G +
Sbjct:  512 GHIKPFCYHLHGHPHHGTQSSSSGRKM--MWVPKHKIVSLVVHTSLRASAKEDWYLDSGCSRHMTGVKEFLVNIEPCSTSYVTFGDGSKGKITGMGKL 607          
BLAST of U74095 vs. Soybean peptides
Match: Glyma01g24090.1|PACid:16244352 ()

HSP 1 Score: 94.3597 bits (233), Expect = 2.437e-20
Identity = 50/98 (51.02%), Postives = 65/98 (66.33%), Query Frame = -1
Query:   17 GHIKAFYYWFIGFPNKPCMSGLSIKHISAMXXLRNNNGMLG*HTLLRASSREDWYLDSGCSRHXTGMENLLVDIQPHTTSYVTFGDGAKEKIKGVGXM 310
            GHIK F Y   G P+    S  S K +  M   ++    L  HT LRAS++EDWYLDSGCSRH TG++  L++I+P +TSYVTFGDG+K KI G+G +
Sbjct:  511 GHIKPFCYHLHGHPHHGTQSSNSRKKM--MWVPKHKAVSLVVHTSLRASAKEDWYLDSGCSRHMTGVKEFLLNIEPCSTSYVTFGDGSKGKIIGMGKL 606          
BLAST of U74095 vs. Soybean peptides
Match: Glyma15g26820.1|PACid:16299838 ()

HSP 1 Score: 93.5893 bits (231), Expect = 4.157e-20
Identity = 49/98 (50.00%), Postives = 64/98 (65.31%), Query Frame = -1
Query:   17 GHIKAFYYWFIGFPNKPCMSGLSIKHISAMXXLRNNNGMLG*HTLLRASSREDWYLDSGCSRHXTGMENLLVDIQPHTTSYVTFGDGAKEKIKGVGXM 310
            GHIK F Y   G P+       S + +  M   ++    L  HT LRAS++EDWYLDSGCSRH TG++  LV+I+P +TSYVTFGDG+K KI G+G +
Sbjct:  511 GHIKPFCYHLHGHPHHGTQGSSSGRKM--MWVPKHKTVSLVVHTSLRASAKEDWYLDSGCSRHMTGVKEFLVNIEPCSTSYVTFGDGSKGKIIGMGRL 606          
BLAST of U74095 vs. Soybean peptides
Match: Glyma16g14490.1|PACid:16302197 ()

HSP 1 Score: 91.6633 bits (226), Expect = 1.580e-19
Identity = 49/98 (50.00%), Postives = 64/98 (65.31%), Query Frame = -1
Query:   17 GHIKAFYYWFIGFPNKPCMSGLSIKHISAMXXLRNNNGMLG*HTLLRASSREDWYLDSGCSRHXTGMENLLVDIQPHTTSYVTFGDGAKEKIKGVGXM 310
            GHIK F Y   G P+    S  S + +  M   ++    L  HT LRAS++EDWYLDSG SRH TG++  LV+I+P +TSYVTFGDG+K KI G+G +
Sbjct:  507 GHIKPFCYHLHGHPHHGTQSSSSGRKM--MWVPKHKTVSLVVHTSLRASAKEDWYLDSGYSRHMTGVKEFLVNIEPCSTSYVTFGDGSKGKITGMGKL 602          
BLAST of U74095 vs. Soybean peptides
Match: Glyma14g18800.1|PACid:16295699 ()

HSP 1 Score: 54.6842 bits (130), Expect = 2.140e-8
Identity = 25/55 (45.45%), Postives = 35/55 (63.64%), Query Frame = -1
Query:    2 SSREDWYLDSGCSRHXTGMENLLVDIQPHTTSYVTFGDGAKEKIKGVGXMDCSET 166
            S R+ WY++SGCS+H TG  + L  I P  + +VT+GD  K KI GVG +  S +
Sbjct:   42 SVRKKWYINSGCSKHMTGDVSKLTTISPKKSGHVTYGDNNKGKIIGVGKIGTSSS 96          
BLAST of U74095 vs. Soybean peptides
Match: Glyma01g20430.1|PACid:16244126 ()

HSP 1 Score: 54.6842 bits (130), Expect = 2.140e-8
Identity = 22/49 (44.90%), Postives = 33/49 (67.35%), Query Frame = -1
Query:   14 REDWYLDSGCSRHXTGMENLLVDIQPHTTSYVTFGDGAKEKIKGVGXMD 160
            ++ WY+DSGCS+H TG ++    I P  + +VT+GD  K +I GVG +D
Sbjct:  397 KKKWYIDSGCSKHMTGDKSKFTHISPKKSGHVTYGDNNKGRILGVGKID 445          
BLAST of U74095 vs. Soybean peptides
Match: Glyma11g25770.1|PACid:16284680 ()

HSP 1 Score: 51.6026 bits (122), Expect = 1.812e-7
Identity = 22/51 (43.14%), Postives = 32/51 (62.75%), Query Frame = -1
Query:   14 SSREDWYLDSGCSRHXTGMENLLVDIQPHTTSYVTFGDGAKEKIKGVGXMD 166
            S R+ WY+DSGCS+H TG  +    I P  + +VT+GD  K +I GV  ++
Sbjct:  333 SLRKKWYIDSGCSKHMTGDASNFTHISPKKSGHVTYGDNNKGRILGVDSLE 383          
BLAST of U74095 vs. Soybean peptides
Match: Glyma03g21660.1|PACid:16251993 ()

HSP 1 Score: 51.6026 bits (122), Expect = 1.812e-7
Identity = 22/51 (43.14%), Postives = 32/51 (62.75%), Query Frame = -1
Query:   14 SSREDWYLDSGCSRHXTGMENLLVDIQPHTTSYVTFGDGAKEKIKGVGXMD 166
            S R+ WY+DSGCS+H TG  +    I P  + +VT+GD  K +I GV  ++
Sbjct:  375 SLRKKWYIDSGCSKHMTGDASNFTHISPKKSGHVTYGDNNKGRILGVDSLE 425          
The following BLAST results are available for this feature:
BLAST of U74095 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl)
Total hits: 8
Match NameE-valueIdentityDescription
O65147_SOYBN1.399e-1851.02Gag-pol polyprotein OS=Glycine max GN=pol PE=4 SV=... [more]
Q84VI0_SOYBN3.116e-1851.02Gag-pol polyprotein OS=Glycine max GN=gag-pol PE=4... [more]
Q84VI2_SOYBN4.070e-1851.02Gag-pol polyprotein OS=Glycine max GN=gag-pol PE=4... [more]
Q84VH8_SOYBN4.070e-1851.02Gag-pol polyprotein OS=Glycine max GN=gag-pol PE=4... [more]
Q84VH6_SOYBN9.066e-1850.00Gag-pol polyprotein OS=Glycine max GN=gag-pol PE=4... [more]
Q84VI4_SOYBN2.916e-1650.00Gag-pol polyprotein OS=Glycine max GN=gag-pol PE=4... [more]
A2Q2L9_MEDTR6.081e-1460.71Gag-pol polyprotein, related OS=Medicago truncatul... [more]
Q9SKW9_ARATH4.221e-741.67F5J5.1 OS=Arabidopsis thaliana PE=4 SV=1[more]
back to top
BLAST of U74095 vs. TrEMBL
Analysis Date: 2011-04-27 (Homology Analysis: Pisum sativum unigene v2 vs Trembl)
Total hits: 8
Match NameE-valueIdentityDescription
O65147_SOYBN1.749e-1851.02Gag-pol polyprotein OS=Glycine max GN=pol PE=4 SV=... [more]
Q84VI0_SOYBN3.897e-1851.02Gag-pol polyprotein OS=Glycine max GN=gag-pol PE=4... [more]
Q84VI2_SOYBN5.089e-1851.02Gag-pol polyprotein OS=Glycine max GN=gag-pol PE=4... [more]
Q84VH8_SOYBN5.089e-1851.02Gag-pol polyprotein OS=Glycine max GN=gag-pol PE=4... [more]
Q84VH6_SOYBN1.134e-1750.00Gag-pol polyprotein OS=Glycine max GN=gag-pol PE=4... [more]
Q84VI4_SOYBN3.647e-1650.00Gag-pol polyprotein OS=Glycine max GN=gag-pol PE=4... [more]
A2Q2L9_MEDTR7.605e-1460.71Gag-pol polyprotein, related OS=Medicago truncatul... [more]
Q9SKW9_ARATH5.279e-741.67F5J5.1 OS=Arabidopsis thaliana PE=4 SV=1[more]
back to top
BLAST of U74095 vs. Soybean peptides
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Soybean peptides)
Total hits: 10
Match NameE-valueIdentityDescription
Glyma10g22170.1|PACid:162797541.094e-2052.04[more]
Glyma15g32290.1|PACid:163000071.429e-2051.02[more]
Glyma09g26090.1|PACid:162762731.866e-2051.02[more]
Glyma01g24090.1|PACid:162443522.437e-2051.02[more]
Glyma15g26820.1|PACid:162998384.157e-2050.00[more]
Glyma16g14490.1|PACid:163021971.580e-1950.00[more]
Glyma14g18800.1|PACid:162956992.140e-845.45[more]
Glyma01g20430.1|PACid:162441262.140e-844.90[more]
Glyma11g25770.1|PACid:162846801.812e-743.14[more]
Glyma03g21660.1|PACid:162519931.812e-743.14[more]
back to top
Properties
Property NameValue
Singlet in analysisPisum sativum unigene v2
Singlet in analysisPisum sativum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>U74095 ID=U74095|Name=U74095|organism=Pisum sativum|type=EST|length=313bp
TGGTTTCAGAACAGTCCATTNNNCCCACACCTTTTATTTTTTCTTTGGCA
CCATCACCAAAGGTCACATAGCTGGTAGTGTGAGGTTGAATGTCTACCAG
TAGATTTTCCATACCAGTCANATGTCTTGAGCATCCACTGTCAAGGTACC
AGTCTTCTCTGGAAGANGCCCTTAGGAGTGTGTGCTATCCTAGCATACCA
TTGTTGTTTCTTAATGNNAACATAGCGCTTATGTGTTTTATGCTTAGGCC
TGACATGCAAGGTTTGTTAGGGAAACCAATGAACCAGTAGTAGAAGGCTT
TTATATGACCCAA
back to top