FG534363
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FG534363 vs. TrEMBL
Match: A2Q5P0_MEDTR (Putative uncharacterized protein OS=Medicago truncatula GN=MtrDRAFT_AC167711g44v2 PE=4 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 7.059e-13 Identity = 37/55 (67.27%), Postives = 40/55 (72.73%), Query Frame = 3 Query: 156 IYSLDDDHNMQIIWAVNHALITRSCFIHQTYVPVSLEIKDTVVRAYRTDPVQVRS 320 + S DD VNHALITRS + Q YVPVSLEIKDTVVR+YRTDPVQVRS Sbjct: 29 LQSTYDDSRRSHHRTVNHALITRSQILIQIYVPVSLEIKDTVVRSYRTDPVQVRS 83 HSP 2 Score: 28.8758 bits (63), Expect = 7.059e-13 Identity = 11/19 (57.89%), Postives = 13/19 (68.42%), Query Frame = 2 Query: 107 RTPCDHPSW*APTKNDHLQ 163 R PCDHP+ +NDHLQ Sbjct: 12 RLPCDHPNQTGLAENDHLQ 30
BLAST of FG534363 vs. TrEMBL
Match: A2Q5R0_MEDTR (Putative uncharacterized protein OS=Medicago truncatula GN=MtrDRAFT_AC167711g28v2 PE=4 SV=1) HSP 1 Score: 72.4034 bits (176), Expect = 2.277e-11 Identity = 43/71 (60.56%), Postives = 47/71 (66.20%), Query Frame = 3 Query: 108 EHRVTTPVGRHQLRTIIYSLDDDHNMQIIWAVNHALITRSCFIHQTYVPVSLEIKDTVVRAYRTDPVQVRS 320 + RVTTP R + S DD VNHALITRS + Q YVPVSLEIKDTVVR+YRTDPVQVRS Sbjct: 50 DSRVTTPT-RLAENDHLQSTHDDSRGSHHRTVNHALITRSQILIQIYVPVSLEIKDTVVRSYRTDPVQVRS 119 The following BLAST results are available for this feature:
BLAST of FG534363 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FG534363 ID=FG534363; Name=FG534363; organism=Pisum sativum; type=EST; length=560bpback to top |