Pisum_sativum_v1_Contig194
Contig Overview
Alignments
The following features are aligned
Unigenes
This contig is part of the following unigenes:
Analyses
This contig is derived from or has results from the following analyses
Relationships
The following EST feature(s) are a part of this contig:
Homology
BLAST of Pisum_sativum_v1_Contig194 vs. Medicago proteins
Match: IMGA|Medtr4g098250.1 (Transcription factor bHLH25 (AHRD V1 *-*- Q9T072); contains Interpro domain(s) IPR011598 Helix-loop-helix DNA-binding chr04_pseudomolecule_IMGAG_V3.5 34005787-34008539 E EGN_Mt100125 20100825) HSP 1 Score: 68.5514 bits (166), Expect = 1.888e-12 Identity = 41/73 (56.16%), Postives = 48/73 (65.75%), Query Frame = -1 Query: 6 KWMSTV------YFRKECYLNFLDDDDK*EFLSLDIDTVFQEQNQQQCLNSE---TTFNNSFTDETNFESFDF 197 KW+S + F +EC LNFLD D++ EFL QEQ QQQCL+SE TTF NSFTDETNF+SFDF Sbjct: 17 KWLSDLEMDEYNLFPEECNLNFLDADEE-EFLP-------QEQTQQQCLSSESNSTTFTNSFTDETNFDSFDF 81
BLAST of Pisum_sativum_v1_Contig194 vs. Medicago proteins
Match: IMGA|Medtr4g098210.1 (Transcription factor bHLH25 (AHRD V1 **-- Q9T072); contains Interpro domain(s) IPR011598 Helix-loop-helix DNA-binding chr04_pseudomolecule_IMGAG_V3.5 33975244-33977876 E EGN_Mt100125 20100825) HSP 1 Score: 57.7658 bits (138), Expect = 3.333e-9 Identity = 34/64 (53.12%), Postives = 43/64 (67.19%), Query Frame = -1 Query: 6 FRKECYLNFLDDDDK*EFLSLDIDTV--FQEQNQ--QQCLNSE---TTFNNSFTDETNFESFDF 176 F +ECYLN LD D EFLS D+ +V F+EQ + QQCL +E TT + +F ET+FESFDF Sbjct: 29 FDEECYLNLLDADVVEEFLSRDMASVIAFEEQRETLQQCLTTECISTTLSETFNGETSFESFDF 92 The following BLAST results are available for this feature:
BLAST of Pisum_sativum_v1_Contig194 vs. Medicago proteins
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Medicago proteins) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
contig sequence >Pisum_sativum_v1_Contig194 ID=Pisum_sativum_v1_Contig194; Name=Pisum_sativum_v1_Contig194; organism=Pisum sativum; type=contig; length=506bpback to top |