Pisum_sativum_v1_Contig2841
Contig Overview
Alignments
The following features are aligned
Unigenes
This contig is part of the following unigenes:
Analyses
This contig is derived from or has results from the following analyses
Relationships
The following EST feature(s) are a part of this contig:
Homology
BLAST of Pisum_sativum_v1_Contig2841 vs. TrEMBL
Match: Q9M445_CICAR (Putative uncharacterized protein (Fragment) OS=Cicer arietinum PE=2 SV=1) HSP 1 Score: 101.679 bits (252), Expect = 2.610e-20 Identity = 48/72 (66.67%), Postives = 53/72 (73.61%), Query Frame = 3 Query: 207 NDTGNNGTIDAFNNQGGHQDYGEADIKTGAHITNGGYTNLHNNGTKHAFNNSYGGTQNFGKATINTGARIGN 422 N GNNGT+DAFNN+ G QDY EA+ TGA I G Y NNGTK AFNNS+GGTQ FGKA NTGA+IGN Sbjct: 12 NYGGNNGTVDAFNNKLGTQDYDEAEFNTGAEIKKGSYPTHSNNGTKKAFNNSWGGTQKFGKAKFNTGAKIGN 83
BLAST of Pisum_sativum_v1_Contig2841 vs. TrEMBL
Match: B7FH39_MEDTR (Putative uncharacterized protein OS=Medicago truncatula PE=4 SV=1) HSP 1 Score: 61.6178 bits (148), Expect = 2.993e-8 Identity = 41/69 (59.42%), Postives = 45/69 (65.22%), Query Frame = 1 Query: 250 RVAIKIMVRLTSKLVHILPMEVILIFITMEPSMHSTTHMEELRILERPRLTLALGLETKLHRSFMGASQ 456 RVA KI +RL SKLV LP V L+ +TMEP M STT MEELR LERP TL LE K +GASQ Sbjct: 10 RVANKISLRLNSKLVQKLP-RVTLLIVTMEPKMLSTTQMEELRNLERPSSTLGHILEIKP----LGASQ 73 The following BLAST results are available for this feature:
BLAST of Pisum_sativum_v1_Contig2841 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl) Total hits: 2
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
Sequences
The
following sequences are available for this feature:
contig sequence >Pisum_sativum_v1_Contig2841 ID=Pisum_sativum_v1_Contig2841; Name=Pisum_sativum_v1_Contig2841; organism=Pisum sativum; type=contig; length=509bpback to top |