GT625158
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GT625158 vs. TrEMBL
Match: D7TB29_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_130.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00000247001 PE=4 SV=1) HSP 1 Score: 79.337 bits (194), Expect = 1.364e-13 Identity = 34/55 (61.82%), Postives = 42/55 (76.36%), Query Frame = 1 Query: 1 DDGERMMACDTCGVWRHTRCSGIPDTAPVPARFVCQRCQNCDSKPI-SGEHYKEE 162 DDGERM+ACD CGVW+HTRC+ IPD+A VPARF+C RC + P + EH K+E Sbjct: 631 DDGERMLACDGCGVWQHTRCAEIPDSAAVPARFICWRCGSSGQMPTPASEHCKDE 685
BLAST of GT625158 vs. TrEMBL
Match: B9INZ8_POPTR (Predicted protein (Fragment) OS=Populus trichocarpa GN=POPTRDRAFT_738146 PE=4 SV=1) HSP 1 Score: 76.2554 bits (186), Expect = 1.155e-12 Identity = 30/38 (78.95%), Postives = 34/38 (89.47%), Query Frame = 1 Query: 1 DDGERMMACDTCGVWRHTRCSGIPDTAPVPARFVCQRC 114 DDGERM+ACD CGVW+HTRCSGIPD+ PVPA+FVC C Sbjct: 642 DDGERMLACDVCGVWQHTRCSGIPDSDPVPAKFVCVGC 679
BLAST of GT625158 vs. TrEMBL
Match: B9H427_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_759447 PE=4 SV=1) HSP 1 Score: 76.2554 bits (186), Expect = 1.155e-12 Identity = 30/39 (76.92%), Postives = 35/39 (89.74%), Query Frame = 1 Query: 1 DDGERMMACDTCGVWRHTRCSGIPDTAPVPARFVCQRCQ 117 DDGERM+ACD CGVW+HTRCSGIPD+ VPA+FVC RC+ Sbjct: 646 DDGERMLACDVCGVWQHTRCSGIPDSDSVPAKFVCLRCR 684
BLAST of GT625158 vs. TrEMBL
Match: B9RY52_RICCO (DNA binding protein, putative OS=Ricinus communis GN=RCOM_0814500 PE=4 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 7.486e-12 Identity = 28/40 (70.00%), Postives = 36/40 (90.00%), Query Frame = 1 Query: 1 DDGERMMACDTCGVWRHTRCSGIPDTAPVPARFVCQRCQN 120 DDGERM+ACD CGVW+HTRCSGI D+ VPA+F+C+RC++ Sbjct: 628 DDGERMLACDVCGVWQHTRCSGILDSDSVPAKFICRRCRD 667
BLAST of GT625158 vs. TrEMBL
Match: B9S1T6_RICCO (DNA binding protein, putative OS=Ricinus communis GN=RCOM_0868160 PE=4 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 2.178e-11 Identity = 34/77 (44.16%), Postives = 43/77 (55.84%), Query Frame = 1 Query: 1 DDGERMMACDTCGVWRHTRCSGIPDTAPVPARFVCQRCQNCDSKPISGEHYKEEXXXXXXXXXXXCFGNGAPVLSDV 231 DDGE+M+ACDTCGVW+HTRC+GI ++ +P+ FVC RC N + KEE C G P S V Sbjct: 625 DDGEKMLACDTCGVWQHTRCAGIDNSDTIPSMFVCLRCMNARRRECK---RKEEVPCQSITTSSTCRGEAVPTGSVV 698
BLAST of GT625158 vs. TrEMBL
Match: Q8LJG8_ORYSJ (Os01g0877500 protein OS=Oryza sativa subsp. japonica GN=P0471B04.9 PE=2 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.412e-10 Identity = 26/38 (68.42%), Postives = 32/38 (84.21%), Query Frame = 1 Query: 1 DDGERMMACDTCGVWRHTRCSGIPDTAPVPARFVCQRC 114 DDGERM+ACD CGVW+HTRCSGI D VP +F+C++C Sbjct: 630 DDGERMLACDVCGVWQHTRCSGISDFDDVPEKFICRKC 667
BLAST of GT625158 vs. TrEMBL
Match: A2WXJ6_ORYSI (Putative uncharacterized protein OS=Oryza sativa subsp. indica GN=OsI_04645 PE=4 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.412e-10 Identity = 26/38 (68.42%), Postives = 32/38 (84.21%), Query Frame = 1 Query: 1 DDGERMMACDTCGVWRHTRCSGIPDTAPVPARFVCQRC 114 DDGERM+ACD CGVW+HTRCSGI D VP +F+C++C Sbjct: 630 DDGERMLACDVCGVWQHTRCSGISDFDDVPEKFICRKC 667
BLAST of GT625158 vs. TrEMBL
Match: C5XRD3_SORBI (Putative uncharacterized protein Sb03g041550 OS=Sorghum bicolor GN=Sb03g041550 PE=4 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 1.844e-10 Identity = 28/48 (58.33%), Postives = 33/48 (68.75%), Query Frame = 1 Query: 1 DDGERMMACDTCGVWRHTRCSGIPDTAPVPARFVCQRCQNCDSKPISG 144 DDGERM+ACD CGVW+HTRCSGI D VP F+C++C K G Sbjct: 625 DDGERMLACDICGVWQHTRCSGISDFEEVPENFICRKCATRKGKGRGG 672
BLAST of GT625158 vs. TrEMBL
Match: B9T5F9_RICCO (DNA binding protein, putative OS=Ricinus communis GN=RCOM_0052530 PE=4 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 3.145e-10 Identity = 32/54 (59.26%), Postives = 37/54 (68.52%), Query Frame = 1 Query: 1 DDGERMMACDTCGVWRHTRCSGIPDTAPVPARFVCQRCQNCDSKPISGEHYKEE 162 DDGERM+ACD C VW+HTRC+GI D+ VP FVC RC CDS S + K E Sbjct: 621 DDGERMVACDICEVWQHTRCNGIEDSEAVPLLFVCTRC--CDSMIKSRKKVKVE 672
BLAST of GT625158 vs. TrEMBL
Match: C5WN10_SORBI (Putative uncharacterized protein Sb01g010120 OS=Sorghum bicolor GN=Sb01g010120 PE=4 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 1.195e-9 Identity = 30/50 (60.00%), Postives = 33/50 (66.00%), Query Frame = 1 Query: 1 DDGERMMACDTCGVWRHTRCSGIPDTAPVPARFVCQRCQNC--DSKPISG 144 DDGERM+ACD C VW HTRC GI D APVP F+C C + PISG Sbjct: 648 DDGERMVACDACNVWHHTRCVGIADGAPVPPLFLCISCSGALMAAGPISG 697
BLAST of GT625158 vs. SwissProt
Match: Y1342_ARATH (PHD finger protein At1g33420 OS=Arabidopsis thaliana GN=At1g33420 PE=1 SV=1) HSP 1 Score: 63.5438 bits (153), Expect = 4.450e-10 Identity = 26/44 (59.09%), Postives = 32/44 (72.73%), Query Frame = 1 Query: 1 DDGERMMACDTCGVWRHTRCSGIPDTAPVPARFVCQRCQNCDSK 132 DDGERM+ACD CGVW HTRC GI + +P++F+C RC SK Sbjct: 613 DDGERMLACDGCGVWHHTRCIGINNADALPSKFLCFRCIELYSK 656
BLAST of GT625158 vs. TAIR peptide
Match: AT1G33420.1 (| Symbols: | RING/FYVE/PHD zinc finger superfamily protein | chr1:12121063-12123346 REVERSE LENGTH=697) HSP 1 Score: 63.5438 bits (153), Expect = 5.305e-11 Identity = 26/44 (59.09%), Postives = 32/44 (72.73%), Query Frame = 1 Query: 1 DDGERMMACDTCGVWRHTRCSGIPDTAPVPARFVCQRCQNCDSK 132 DDGERM+ACD CGVW HTRC GI + +P++F+C RC SK Sbjct: 613 DDGERMLACDGCGVWHHTRCIGINNADALPSKFLCFRCIELYSK 656
BLAST of GT625158 vs. TAIR peptide
Match: AT1G66170.1 (| Symbols: MMD1 | RING/FYVE/PHD zinc finger superfamily protein | chr1:24638793-24641222 REVERSE LENGTH=704) HSP 1 Score: 60.4622 bits (145), Expect = 4.491e-10 Identity = 23/38 (60.53%), Postives = 28/38 (73.68%), Query Frame = 1 Query: 1 DDGERMMACDTCGVWRHTRCSGIPDTAPVPARFVCQRC 114 DDGERM++CD C VW+HTRC GI D+ +P FVC C Sbjct: 616 DDGERMISCDVCEVWQHTRCCGIDDSDTLPPLFVCSNC 653
BLAST of GT625158 vs. TAIR peptide
Match: AT2G01810.1 (| Symbols: | RING/FYVE/PHD zinc finger superfamily protein | chr2:347537-349952 FORWARD LENGTH=697) HSP 1 Score: 56.6102 bits (135), Expect = 6.485e-9 Identity = 22/38 (57.89%), Postives = 26/38 (68.42%), Query Frame = 1 Query: 1 DDGERMMACDTCGVWRHTRCSGIPDTAPVPARFVCQRC 114 DDGERM+ACD C VW HT C+ I D VP+ F+C C Sbjct: 645 DDGERMVACDACKVWHHTLCNSIEDDEAVPSVFLCNMC 682
BLAST of GT625158 vs. TAIR peptide
Match: AT5G22260.1 (| Symbols: MS1 | RING/FYVE/PHD zinc finger superfamily protein | chr5:7367707-7370192 REVERSE LENGTH=672) HSP 1 Score: 55.8398 bits (133), Expect = 1.106e-8 Identity = 21/38 (55.26%), Postives = 26/38 (68.42%), Query Frame = 1 Query: 1 DDGERMMACDTCGVWRHTRCSGIPDTAPVPARFVCQRC 114 +DGERM+ CD C VW+HTRC G+ VP F+CQ C Sbjct: 624 EDGERMVCCDICEVWQHTRCVGVQHNEEVPRIFLCQSC 661 The following BLAST results are available for this feature:
BLAST of GT625158 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Lens culinaris unigene v1 vs Trembl) Total hits: 10
BLAST of GT625158 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Lens culinaris unigene v1 vs Swissprot) Total hits: 1
BLAST of GT625158 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Lens culinaris unigene v1 vs TAIR 10 peptide) Total hits: 4
InterPro
Analysis Name: InterProScan analysis for Lens culinaris unigene v1
Date Performed: 2011-01-06
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GT625158 ID=GT625158; Name=GT625158; organism=Lens culinaris; type=EST; length=445bpback to top |