GT626785
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GT626785 vs. TrEMBL
Match: C7E2U1_9ROSI (Biotin carboxyl carrier protein subunit OS=Jatropha curcas PE=2 SV=1) HSP 1 Score: 62.7734 bits (151), Expect = 1.311e-8 Identity = 30/34 (88.24%), Postives = 32/34 (94.12%), Query Frame = -2 Query: 262 MNEIEADQSGTIAEILVEDGKPVSVGLPLFAIAP 363 MNEIEADQ+GTIAEILVEDGKPVSV +PLF IAP Sbjct: 237 MNEIEADQAGTIAEILVEDGKPVSVDMPLFVIAP 270
BLAST of GT626785 vs. TrEMBL
Match: C6TK92_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 60.4622 bits (145), Expect = 6.504e-8 Identity = 28/34 (82.35%), Postives = 30/34 (88.24%), Query Frame = -2 Query: 262 MNEIEADQSGTIAEILVEDGKPVSVGLPLFAIAP 363 MNEIEADQSGTIAE+L EDGKPVSV +PLF I P Sbjct: 247 MNEIEADQSGTIAEVLAEDGKPVSVDMPLFVIVP 280
BLAST of GT626785 vs. TrEMBL
Match: D7SXK0_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_108.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00011511001 PE=4 SV=1) HSP 1 Score: 58.5362 bits (140), Expect = 2.472e-7 Identity = 28/34 (82.35%), Postives = 29/34 (85.29%), Query Frame = -2 Query: 262 MNEIEADQSGTIAEILVEDGKPVSVGLPLFAIAP 363 MNEIEADQSGTIAEIL EDGKPVS+ PL IAP Sbjct: 237 MNEIEADQSGTIAEILAEDGKPVSIDTPLLVIAP 270
BLAST of GT626785 vs. TrEMBL
Match: Q9GE06_SOYBN (Biotin carboxyl carrier protein subunit OS=Glycine max GN=accB-2 PE=2 SV=1) HSP 1 Score: 57.7658 bits (138), Expect = 4.216e-7 Identity = 26/34 (76.47%), Postives = 29/34 (85.29%), Query Frame = -2 Query: 262 MNEIEADQSGTIAEILVEDGKPVSVGLPLFAIAP 363 MNEIEADQSGT+AE++ EDGKPVSV PLF I P Sbjct: 251 MNEIEADQSGTVAEVVAEDGKPVSVDTPLFVIVP 284
BLAST of GT626785 vs. TrEMBL
Match: Q9FQ74_SOYBN (Biotin carboxyl carrier protein subunit OS=Glycine max GN=accB-2 PE=4 SV=1) HSP 1 Score: 57.7658 bits (138), Expect = 4.216e-7 Identity = 26/34 (76.47%), Postives = 29/34 (85.29%), Query Frame = -2 Query: 262 MNEIEADQSGTIAEILVEDGKPVSVGLPLFAIAP 363 MNEIEADQSGT+AE++ EDGKPVSV PLF I P Sbjct: 251 MNEIEADQSGTVAEVVAEDGKPVSVDTPLFVIVP 284
BLAST of GT626785 vs. TrEMBL
Match: B9SJD0_RICCO (Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP2) OS=Ricinus communis GN=RCOM_0525570 PE=4 SV=1) HSP 1 Score: 57.7658 bits (138), Expect = 4.216e-7 Identity = 27/34 (79.41%), Postives = 28/34 (82.35%), Query Frame = -2 Query: 262 MNEIEADQSGTIAEILVEDGKPVSVGLPLFAIAP 363 MNEIEADQSGTI E+L EDGKPVSV PLF I P Sbjct: 227 MNEIEADQSGTITEVLAEDGKPVSVDTPLFVIVP 260
BLAST of GT626785 vs. TrEMBL
Match: A9P0L3_PICSI (Putative uncharacterized protein OS=Picea sitchensis PE=2 SV=1) HSP 1 Score: 57.7658 bits (138), Expect = 4.216e-7 Identity = 27/34 (79.41%), Postives = 30/34 (88.24%), Query Frame = -2 Query: 262 MNEIEADQSGTIAEILVEDGKPVSVGLPLFAIAP 363 MNEIEAD+SGTI EILVEDGKPV+V +PLF I P Sbjct: 276 MNEIEADRSGTIVEILVEDGKPVAVDMPLFVIKP 309
BLAST of GT626785 vs. TrEMBL
Match: C0LLW0_SUASA (Acetyl-coenzyme A carboxylase (Fragment) OS=Suaeda salsa PE=2 SV=1) HSP 1 Score: 57.3806 bits (137), Expect = 5.506e-7 Identity = 27/34 (79.41%), Postives = 29/34 (85.29%), Query Frame = -2 Query: 262 MNEIEADQSGTIAEILVEDGKPVSVGLPLFAIAP 363 MNEIEADQSGTI EIL +DGKPVSV +PLF I P Sbjct: 224 MNEIEADQSGTIVEILAKDGKPVSVDMPLFVIEP 257
BLAST of GT626785 vs. TrEMBL
Match: D7SXK1_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_108.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00011513001 PE=4 SV=1) HSP 1 Score: 56.6102 bits (135), Expect = 9.392e-7 Identity = 27/34 (79.41%), Postives = 28/34 (82.35%), Query Frame = -2 Query: 262 MNEIEADQSGTIAEILVEDGKPVSVGLPLFAIAP 363 MNEIEADQSGTI EIL EDGKPVS+ PL IAP Sbjct: 38 MNEIEADQSGTITEILAEDGKPVSIDRPLLVIAP 71
BLAST of GT626785 vs. TrEMBL
Match: B9IQ25_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_665593 PE=4 SV=1) HSP 1 Score: 56.6102 bits (135), Expect = 9.392e-7 Identity = 27/34 (79.41%), Postives = 28/34 (82.35%), Query Frame = -2 Query: 262 MNEIEADQSGTIAEILVEDGKPVSVGLPLFAIAP 363 MNEIEADQ+GTI EIL EDGKPVSV PLF I P Sbjct: 251 MNEIEADQTGTIVEILAEDGKPVSVDTPLFVIEP 284
BLAST of GT626785 vs. SwissProt
Match: BCCP2_ARATH (Biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic OS=Arabidopsis thaliana GN=BCCP2 PE=1 SV=1) HSP 1 Score: 55.4546 bits (132), Expect = 1.022e-7 Identity = 26/34 (76.47%), Postives = 29/34 (85.29%), Query Frame = -2 Query: 262 MNEIEADQSGTIAEILVEDGKPVSVGLPLFAIAP 363 MNEIEA++SGTI E+L EDGKPVSV PLF IAP Sbjct: 222 MNEIEAEKSGTIMELLAEDGKPVSVDTPLFVIAP 255
BLAST of GT626785 vs. TAIR peptide
Match: AT5G15530.1 (| Symbols: BCCP2, CAC1-B | biotin carboxyl carrier protein 2 | chr5:5038955-5040437 FORWARD LENGTH=255) HSP 1 Score: 55.4546 bits (132), Expect = 8.726e-9 Identity = 26/34 (76.47%), Postives = 29/34 (85.29%), Query Frame = -2 Query: 262 MNEIEADQSGTIAEILVEDGKPVSVGLPLFAIAP 363 MNEIEA++SGTI E+L EDGKPVSV PLF IAP Sbjct: 222 MNEIEAEKSGTIMELLAEDGKPVSVDTPLFVIAP 255
BLAST of GT626785 vs. TAIR peptide
Match: AT5G16390.1 (| Symbols: CAC1, CAC1A, BCCP, BCCP1 | chloroplastic acetylcoenzyme A carboxylase 1 | chr5:5361098-5363020 REVERSE LENGTH=280) HSP 1 Score: 49.2914 bits (116), Expect = 6.253e-7 Identity = 20/34 (58.82%), Postives = 27/34 (79.41%), Query Frame = -2 Query: 262 MNEIEADQSGTIAEILVEDGKPVSVGLPLFAIAP 363 MNEIE+D +GT+ +I+ EDGKPVS+ PLF + P Sbjct: 247 MNEIESDHTGTVVDIVAEDGKPVSLDTPLFVVQP 280 The following BLAST results are available for this feature:
BLAST of GT626785 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Lens culinaris unigene v1 vs Trembl) Total hits: 10
BLAST of GT626785 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Lens culinaris unigene v1 vs Swissprot) Total hits: 1
BLAST of GT626785 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Lens culinaris unigene v1 vs TAIR 10 peptide) Total hits: 2
InterPro
Analysis Name: InterProScan analysis for Lens culinaris unigene v1
Date Performed: 2011-01-06
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GT626785 ID=GT626785; Name=GT626785; organism=Lens culinaris; type=EST; length=364bpback to top |