GT620878
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GT620878 vs. TrEMBL
Match: Q6WAY7_PEA (Gag/pol polyprotein (Fragment) OS=Pisum sativum PE=4 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 1.547e-9 Identity = 29/50 (58.00%), Postives = 36/50 (72.00%), Query Frame = 3 Query: 6 YDANARCEFHSGAPSHGTENCKALKNKVQDLIDKKQLTFGERIPLVNGQL 155 YDAN RC+FHSGAP H TE C+AL++KVQDLID K + F +VN + Sbjct: 449 YDANVRCDFHSGAPGHHTEKCRALQHKVQDLIDAKAINFAPVPNVVNNPM 498
BLAST of GT620878 vs. TrEMBL
Match: Q6WAY5_PEA (Gag/pol polyprotein (Fragment) OS=Pisum sativum PE=4 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 1.547e-9 Identity = 29/50 (58.00%), Postives = 36/50 (72.00%), Query Frame = 3 Query: 6 YDANARCEFHSGAPSHGTENCKALKNKVQDLIDKKQLTFGERIPLVNGQL 155 YDAN RC+FHSGAP H TE C+AL++KVQDLID K + F +VN + Sbjct: 449 YDANVRCDFHSGAPGHHTEKCRALQHKVQDLIDAKAINFAPVPNVVNNPM 498
BLAST of GT620878 vs. TrEMBL
Match: Q6WAY3_PEA (Gag/pol polyprotein OS=Pisum sativum PE=4 SV=1) HSP 1 Score: 63.929 bits (154), Expect = 5.880e-9 Identity = 28/50 (56.00%), Postives = 35/50 (70.00%), Query Frame = 3 Query: 6 YDANARCEFHSGAPSHGTENCKALKNKVQDLIDKKQLTFGERIPLVNGQL 155 YDAN RC+FHSGAP H TE C+AL++KVQDLID + F +VN + Sbjct: 447 YDANVRCDFHSGAPGHHTEKCRALQHKVQDLIDANAINFAPVPNVVNNPM 496 The following BLAST results are available for this feature:
BLAST of GT620878 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Lens culinaris unigene v1 vs Trembl) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GT620878 ID=GT620878; Name=GT620878; organism=Lens culinaris; type=EST; length=343bpback to top |