GT624218
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GT624218 vs. TrEMBL
Match: C6SXJ8_SOYBN (Putative uncharacterized protein OS=Glycine max PE=4 SV=1) HSP 1 Score: 78.9518 bits (193), Expect = 1.776e-13 Identity = 38/58 (65.52%), Postives = 45/58 (77.59%), Query Frame = 2 Query: 29 MNHNINQQQSPVIAYPAIGEKNHQVAPPPPMGYPTKDD--PQQTLPVKTTSRGDGFWK 196 MNH QQQSPV AYPA+ + N APPPP+GYPTKDD QQ +P+KT++RGDGFWK Sbjct: 1 MNH---QQQSPVTAYPAVSQSN-PAAPPPPVGYPTKDDVPSQQNVPIKTSTRGDGFWK 54
BLAST of GT624218 vs. TrEMBL
Match: Q2HTZ6_MEDTR (Putative uncharacterized protein OS=Medicago truncatula GN=MtrDRAFT_AC149577g11v1 PE=4 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 1.191e-9 Identity = 33/60 (55.00%), Postives = 40/60 (66.67%), Query Frame = 2 Query: 38 NINQQQSPVIAYPAIGEKN---HQVAPPPPMGYPTKDD----PQQTLPVKTTSRGDGFWK 196 N NQQ++P ++YP GE V PPPMGYP+KD PQQ +P +TTSRGDGFWK Sbjct: 5 NNNQQKAPSVSYPPPGEAYSTPQYVTAPPPMGYPSKDGSAGYPQQRIPDQTTSRGDGFWK 64
BLAST of GT624218 vs. TrEMBL
Match: C6SYK8_SOYBN (Putative uncharacterized protein OS=Glycine max PE=4 SV=1) HSP 1 Score: 60.8474 bits (146), Expect = 5.004e-8 Identity = 30/60 (50.00%), Postives = 39/60 (65.00%), Query Frame = 2 Query: 29 MNHNINQQQSPVIAYPAIGEKNHQ---VAPPPPMGYPTKDDP-QQTLPVKTTSRGDGFWK 196 MNH+ N QQ ++Y G+ N V PPPMGYP+K+ +Q +P +TTSRGDGFWK Sbjct: 1 MNHSSNNQQETPLSYLPEGQANSSAPYVTAPPPMGYPSKNGSIEQRVPEETTSRGDGFWK 60 The following BLAST results are available for this feature:
BLAST of GT624218 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Lens culinaris unigene v1 vs Trembl) Total hits: 3
InterPro
Analysis Name: InterProScan analysis for Lens culinaris unigene v1
Date Performed: 2011-01-06
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GT624218 ID=GT624218; Name=GT624218; organism=Lens culinaris; type=EST; length=406bpback to top |