GT624571
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GT624571 vs. TrEMBL
Match: B6SLU1_MAIZE (Putative uncharacterized protein OS=Zea mays PE=4 SV=1) HSP 1 Score: 76.2554 bits (186), Expect = 3.941e-12 Identity = 35/41 (85.37%), Postives = 39/41 (95.12%), Query Frame = 2 Query: 77 MGGGNGQKAKMARERNLEKQKGGKGSQLETNKKAMSIQVYI 199 MGGGNGQK+KMARERNLEK KG KGSQLETNKKAMSIQ+++ Sbjct: 1 MGGGNGQKSKMARERNLEKNKGAKGSQLETNKKAMSIQIFL 41
BLAST of GT624571 vs. TrEMBL
Match: C5WVL3_SORBI (Putative uncharacterized protein Sb01g031840 OS=Sorghum bicolor GN=Sb01g031840 PE=4 SV=1) HSP 1 Score: 73.1738 bits (178), Expect = 3.336e-11 Identity = 35/38 (92.11%), Postives = 36/38 (94.74%), Query Frame = 2 Query: 77 MGGGNGQKAKMARERNLEKQKGGKGSQLETNKKAMSIQ 190 MGGGNGQK+KMARERNLEK KG KGSQLETNKKAMSIQ Sbjct: 1 MGGGNGQKSKMARERNLEKNKGSKGSQLETNKKAMSIQ 38
BLAST of GT624571 vs. TrEMBL
Match: B6SIA6_MAIZE (Putative uncharacterized protein OS=Zea mays PE=4 SV=1) HSP 1 Score: 73.1738 bits (178), Expect = 3.336e-11 Identity = 35/38 (92.11%), Postives = 36/38 (94.74%), Query Frame = 2 Query: 77 MGGGNGQKAKMARERNLEKQKGGKGSQLETNKKAMSIQ 190 MGGGNGQK+KMARERNLEK KG KGSQLETNKKAMSIQ Sbjct: 1 MGGGNGQKSKMARERNLEKNKGAKGSQLETNKKAMSIQ 38
BLAST of GT624571 vs. TrEMBL
Match: Q75KB8_ORYSJ (Expressed protein, having alternate splicing products OS=Oryza sativa subsp. japonica GN=OSJNBa0054H04.31 PE=4 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 7.432e-11 Identity = 33/41 (80.49%), Postives = 38/41 (92.68%), Query Frame = 2 Query: 77 MGGGNGQKAKMARERNLEKQKGGKGSQLETNKKAMSIQVYI 199 MGGGNGQK++MARERN+EK KG KGSQLETNKKAM+IQV + Sbjct: 1 MGGGNGQKSRMARERNMEKAKGAKGSQLETNKKAMNIQVLV 41
BLAST of GT624571 vs. TrEMBL
Match: Q9ZRV8_CICAR (Putative uncharacterized protein OS=Cicer arietinum PE=4 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 9.706e-11 Identity = 37/39 (94.87%), Postives = 37/39 (94.87%), Query Frame = 2 Query: 77 MGGGNGQKAKMARERNLEKQK-GGKGSQLETNKKAMSIQ 190 MGGGNGQKAKMARERNLEKQK GKGSQLETNKKAMSIQ Sbjct: 1 MGGGNGQKAKMARERNLEKQKNAGKGSQLETNKKAMSIQ 39
BLAST of GT624571 vs. TrEMBL
Match: B9IBV2_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_663761 PE=4 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 9.706e-11 Identity = 36/41 (87.80%), Postives = 39/41 (95.12%), Query Frame = 2 Query: 77 MGGGNGQKAKMARERNLEKQK-GGKGSQLETNKKAMSIQVY 196 MGGGNGQKAKMARE+NLEKQK G KGSQLE+NKKAMSIQV+ Sbjct: 1 MGGGNGQKAKMAREKNLEKQKAGSKGSQLESNKKAMSIQVF 41
BLAST of GT624571 vs. TrEMBL
Match: Q851T2_ORYSJ (Expressed protein OS=Oryza sativa subsp. japonica GN=OSJNBa0051C19.14 PE=4 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 1.268e-10 Identity = 33/39 (84.62%), Postives = 37/39 (94.87%), Query Frame = 2 Query: 77 MGGGNGQKAKMARERNLEKQKGGKGSQLETNKKAMSIQV 193 MGGGNGQK++MARERN+EK KG KGSQLETNKKAM+IQV Sbjct: 1 MGGGNGQKSRMARERNMEKAKGAKGSQLETNKKAMNIQV 39
BLAST of GT624571 vs. TrEMBL
Match: Q0DQW9_ORYSJ (Os03g0439800 protein OS=Oryza sativa subsp. japonica GN=Os03g0439800 PE=4 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 1.268e-10 Identity = 33/39 (84.62%), Postives = 37/39 (94.87%), Query Frame = 2 Query: 77 MGGGNGQKAKMARERNLEKQKGGKGSQLETNKKAMSIQV 193 MGGGNGQK++MARERN+EK KG KGSQLETNKKAM+IQV Sbjct: 1 MGGGNGQKSRMARERNMEKAKGAKGSQLETNKKAMNIQV 39
BLAST of GT624571 vs. TrEMBL
Match: B6T0B0_MAIZE (Putative uncharacterized protein OS=Zea mays PE=4 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 1.656e-10 Identity = 34/41 (82.93%), Postives = 36/41 (87.80%), Query Frame = 2 Query: 77 MGGGNGQKAKMARERNLEKQKGGKGSQLETNKKAMSIQVYI 199 MGGGNGQK+KMARERN EK KGGKGSQLE NKKAM+IQ I Sbjct: 1 MGGGNGQKSKMARERNAEKNKGGKGSQLEANKKAMNIQCKI 41
BLAST of GT624571 vs. TrEMBL
Match: Q0H639_SORBI (Putative uncharacterized protein OS=Sorghum bicolor GN=Sb02g001100 PE=4 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 2.162e-10 Identity = 34/41 (82.93%), Postives = 36/41 (87.80%), Query Frame = 2 Query: 77 MGGGNGQKAKMARERNLEKQKGGKGSQLETNKKAMSIQVYI 199 MGGGNGQK+KMARERN EK KG KGSQLETNKKAM+IQ I Sbjct: 1 MGGGNGQKSKMARERNAEKNKGSKGSQLETNKKAMNIQCKI 41
BLAST of GT624571 vs. SwissProt
Match: Y2309_ARATH (Uncharacterized protein At2g23090 OS=Arabidopsis thaliana GN=At2g23090 PE=1 SV=1) HSP 1 Score: 58.151 bits (139), Expect = 7.091e-8 Identity = 30/39 (76.92%), Postives = 32/39 (82.05%), Query Frame = 2 Query: 77 MGGGNGQKAKMARERNLEKQK-GGKGSQLETNKKAMSIQ 190 MGGGN QK+ MAR +NLEK K GKGSQLE NKKAMSIQ Sbjct: 1 MGGGNAQKSAMARAKNLEKAKAAGKGSQLEANKKAMSIQ 39
BLAST of GT624571 vs. TAIR peptide
Match: AT2G23090.1 (| Symbols: | Uncharacterised protein family SERF | chr2:9829657-9830274 REVERSE LENGTH=78) HSP 1 Score: 58.151 bits (139), Expect = 6.976e-9 Identity = 30/39 (76.92%), Postives = 32/39 (82.05%), Query Frame = 2 Query: 77 MGGGNGQKAKMARERNLEKQK-GGKGSQLETNKKAMSIQ 190 MGGGN QK+ MAR +NLEK K GKGSQLE NKKAMSIQ Sbjct: 1 MGGGNAQKSAMARAKNLEKAKAAGKGSQLEANKKAMSIQ 39 The following BLAST results are available for this feature:
BLAST of GT624571 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Lens culinaris unigene v1 vs Trembl) Total hits: 10
BLAST of GT624571 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Lens culinaris unigene v1 vs Swissprot) Total hits: 1
BLAST of GT624571 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Lens culinaris unigene v1 vs TAIR 10 peptide) Total hits: 1
InterPro
Analysis Name: InterProScan analysis for Lens culinaris unigene v1
Date Performed: 2011-01-06
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GT624571 ID=GT624571; Name=GT624571; organism=Lens culinaris; type=EST; length=848bpback to top Annotated Terms
The
following terms have been associated with
this EST:
|