GH720551

EST Overview
NameGH720551
Unique NameGH720551
TypeEST
OrganismPisum sativum (pea)
Sequence length328
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
Pisum sativum unigene v12010-12-27
Homology Analysis: Pisum sativum unigene v1 vs Trembl2010-12-28
Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide2011-02-03
InterProScan analysis for Pisum sativum unigene v12010-12-29
Libraries
Library NameType
LIBEST_024272 BACIcdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Pisum sativum unigene v1Pisum sativum unigene v1EST
Homology
BLAST of GH720551 vs. TrEMBL
Match: D7U2G8_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_5.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00028103001 PE=4 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 1.291e-8
Identity = 36/75 (48.00%), Postives = 48/75 (64.00%), Query Frame = 3
Query:    6 AAARAGTSVEVLQ---QKSRDEKMEDKF-AMSSPSIANPTVFQGVFCRDLTVVENLLSQRFSSRSIPVKYEALSC 218
            AAA   T+++  Q   Q  ++ ++E++  A      +  +VFQGVFCRDL VV NLLSQ   +R IPVKYEALSC
Sbjct:  484 AAALQATAIQAQQTQEQPKKESELENQATAAPQQQTSTASVFQGVFCRDLAVVGNLLSQAGFNRQIPVKYEALSC 558          
BLAST of GH720551 vs. TrEMBL
Match: A5C448_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_036192 PE=4 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 1.291e-8
Identity = 36/75 (48.00%), Postives = 48/75 (64.00%), Query Frame = 3
Query:    6 AAARAGTSVEVLQ---QKSRDEKMEDKF-AMSSPSIANPTVFQGVFCRDLTVVENLLSQRFSSRSIPVKYEALSC 218
            AAA   T+++  Q   Q  ++ ++E++  A      +  +VFQGVFCRDL VV NLLSQ   +R IPVKYEALSC
Sbjct:  468 AAALQATAIQAQQTQEQPKKESELENQATAAPQQQTSTASVFQGVFCRDLAVVGNLLSQAGFNRQIPVKYEALSC 542          
BLAST of GH720551 vs. TrEMBL
Match: B9RNG2_RICCO (Heat shock protein binding protein, putative OS=Ricinus communis GN=RCOM_1347440 PE=4 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 7.085e-7
Identity = 29/47 (61.70%), Postives = 34/47 (72.34%), Query Frame = 3
Query:   81 AMSSPS-IANPTVFQGVFCRDLTVVENLLSQRFSSRSIPVKYEALSC 218
            A+ +PS   N +VFQGVFCRDL  V NLLSQ   +R +PVKYEAL C
Sbjct:  541 AVKTPSGTTNQSVFQGVFCRDLATVGNLLSQAGFNRPVPVKYEALRC 587          
BLAST of GH720551 vs. TrEMBL
Match: B9I9K7_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_774720 PE=4 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 7.085e-7
Identity = 29/50 (58.00%), Postives = 34/50 (68.00%), Query Frame = 3
Query:   69 EDKFAMSSPSIANPTVFQGVFCRDLTVVENLLSQRFSSRSIPVKYEALSC 218
            ++K + +S       VFQGVFCRDL  V NLLSQ   SR IP+KYEALSC
Sbjct:  485 DNKVSSASAGSTAAPVFQGVFCRDLAAVGNLLSQGGFSRPIPMKYEALSC 534          
BLAST of GH720551 vs. TAIR peptide
Match: AT4G02100.1 (| Symbols: | Heat shock protein DnaJ with tetratricopeptide repeat | chr4:930228-932049 FORWARD LENGTH=546)

HSP 1 Score: 50.0618 bits (118), Expect = 3.446e-7
Identity = 25/46 (54.35%), Postives = 34/46 (73.91%), Query Frame = 3
Query:   81 AMSSPSIANPTVFQGVFCRDLTVVENLLSQRFSSRSIPVKYEALSC 218
            A++  S  N  V +GVFCRDLTVV +L+++   ++ IPVKYEALSC
Sbjct:  501 AVAVNSNNNTNVVKGVFCRDLTVVGSLIARTGFNQPIPVKYEALSC 546          
BLAST of GH720551 vs. TAIR peptide
Match: AT2G47440.1 (| Symbols: | Tetratricopeptide repeat (TPR)-like superfamily protein | chr2:19469912-19471660 FORWARD LENGTH=526)

HSP 1 Score: 48.9062 bits (115), Expect = 7.678e-7
Identity = 22/38 (57.89%), Postives = 27/38 (71.05%), Query Frame = 3
Query:  105 NPTVFQGVFCRDLTVVENLLSQRFSSRSIPVKYEALSC 218
            N   +QGVFCRDL  V NLL++   +  IPVKYEAL+C
Sbjct:  489 NSNAYQGVFCRDLAAVGNLLTRAGFNHPIPVKYEALTC 526          
The following BLAST results are available for this feature:
BLAST of GH720551 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl)
Total hits: 4
Match NameE-valueIdentityDescription
D7U2G8_VITVI1.291e-848.00Whole genome shotgun sequence of line PN40024, sca... [more]
A5C448_VITVI1.291e-848.00Putative uncharacterized protein OS=Vitis vinifera... [more]
B9RNG2_RICCO7.085e-761.70Heat shock protein binding protein, putative OS=Ri... [more]
B9I9K7_POPTR7.085e-758.00Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
back to top
BLAST of GH720551 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide)
Total hits: 2
Match NameE-valueIdentityDescription
AT4G02100.13.446e-754.35| Symbols: | Heat shock protein DnaJ with tetratr... [more]
AT2G47440.17.678e-757.89| Symbols: | Tetratricopeptide repeat (TPR)-like ... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR22904TPR REPEAT CONTAINING PROTEINcoord: 11..63
score: 3.9
NoneNo IPR availablePANTHERPTHR22904:SF7SGT-1-RELATEDcoord: 11..63
score: 3.9

Properties
Property NameValue
Singlet in analysisPisum sativum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>GH720551 ID=GH720551|Name=GH720551|organism=Pisum sativum|type=EST|length=328bp
TTCGAGCGGCCGCCCGGGCAGGTACTTCGGTTGAAGTGTTGCAACAGAAA
AGTAGAGATGAAAAAATGGAGGACAAGTTTGCGATGTCTTCGCCTAGCAT
TGCAAATCCAACGGTGTTTCAAGGAGTGTTTTGCCGAGATCTAACGGTGG
TAGAGAACTTGCTTTCTCAAAGGTTTAGTAGTAGGTCAATTCCGGTCAAA
TACGAGGCTCTTAGTTGTTGAATTCATTGATTGATTGGGGGACTTGGGAT
GTTTTGTTTTTTTACCGGCTGAAAATATCTCTGATTCTGATTATTGGTTA
ATTGTATGTACCTCGGCCGCGACCACGC
back to top