U73754

EST Overview
NameU73754
Unique NameU73754
TypeEST
OrganismPisum sativum (pea)
Sequence length183
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
Pisum sativum unigene v12010-12-27
Homology Analysis: Pisum sativum unigene v1 vs Trembl2010-12-28
Pisum sativum unigene v22011-03-01
Homology Analysis: Pisum sativum unigene v2 vs Trembl2011-04-27
Libraries
Library NameType
LIBEST_000542 Pisum sativum (J.S.Day)cdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Pisum sativum unigene v2Pisum sativum unigene v2EST
Pisum sativum unigene v1Pisum sativum unigene v1EST
Homology
BLAST of U73754 vs. TrEMBL
Match: B9TB32_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1972290 PE=4 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 2.587e-20
Identity = 49/55 (89.09%), Postives = 50/55 (90.91%), Query Frame = -3
Query:    2 GRDSFTCIPASTTKSSGLHAPTTAVQPFLGFVESGFPFTHNGGPHQTRQAATGHN 166
            G DSFTCIPASTTKSSGL+A TTAVQPFLGFVESGFPFTHNGG   TRQAATGHN
Sbjct:   29 GWDSFTCIPASTTKSSGLNALTTAVQPFLGFVESGFPFTHNGGAAPTRQAATGHN 83          
BLAST of U73754 vs. TrEMBL
Match: B9SBB1_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_0650770 PE=4 SV=1)

HSP 1 Score: 59.6918 bits (143), Expect = 1.127e-7
Identity = 29/37 (78.38%), Postives = 31/37 (83.78%), Query Frame = -3
Query:   56 GRDSFTCIPASTTKSSGLHAPTTAVQPFLGFVESGFP 166
            G DSFTCI ASTTKSS L+A TT VQPFL F+ESGFP
Sbjct:   32 GWDSFTCISASTTKSSSLNALTTLVQPFLEFIESGFP 68          
BLAST of U73754 vs. TrEMBL
Match: B9TB32_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1972290 PE=4 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 3.236e-20
Identity = 49/55 (89.09%), Postives = 50/55 (90.91%), Query Frame = -3
Query:    2 GRDSFTCIPASTTKSSGLHAPTTAVQPFLGFVESGFPFTHNGGPHQTRQAATGHN 166
            G DSFTCIPASTTKSSGL+A TTAVQPFLGFVESGFPFTHNGG   TRQAATGHN
Sbjct:   29 GWDSFTCIPASTTKSSGLNALTTAVQPFLGFVESGFPFTHNGGAAPTRQAATGHN 83          
BLAST of U73754 vs. TrEMBL
Match: B9SBB1_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_0650770 PE=4 SV=1)

HSP 1 Score: 59.6918 bits (143), Expect = 1.410e-7
Identity = 29/37 (78.38%), Postives = 31/37 (83.78%), Query Frame = -3
Query:   56 GRDSFTCIPASTTKSSGLHAPTTAVQPFLGFVESGFP 166
            G DSFTCI ASTTKSS L+A TT VQPFL F+ESGFP
Sbjct:   32 GWDSFTCISASTTKSSSLNALTTLVQPFLEFIESGFP 68          
The following BLAST results are available for this feature:
BLAST of U73754 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl)
Total hits: 2
Match NameE-valueIdentityDescription
B9TB32_RICCO2.587e-2089.09Putative uncharacterized protein OS=Ricinus commun... [more]
B9SBB1_RICCO1.127e-778.38Putative uncharacterized protein OS=Ricinus commun... [more]
back to top
BLAST of U73754 vs. TrEMBL
Analysis Date: 2011-04-27 (Homology Analysis: Pisum sativum unigene v2 vs Trembl)
Total hits: 2
Match NameE-valueIdentityDescription
B9TB32_RICCO3.236e-2089.09Putative uncharacterized protein OS=Ricinus commun... [more]
B9SBB1_RICCO1.410e-778.38Putative uncharacterized protein OS=Ricinus commun... [more]
back to top
Properties
Property NameValue
Singlet in analysisPisum sativum unigene v2
Singlet in analysisPisum sativum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>U73754 ID=U73754|Name=U73754|organism=Pisum sativum|type=EST|length=183bp
CGTTATGACCCGTGGCCGCCTGCCTGGTCTGGTGGGGTCCTCCGTTGTGG
GTAAACGGGAAACCCGACTCTACGAACCCGAGGAAAGGCTGCACAGCAGT
AGTAGGGGCGTGAAGACCGGAGCTTTTTGTAGTGCTAGCAGGAATGCAAG
TGAATGAATCCCGTCCCACGGTTCCATGAATTC
back to top