FG535207
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FG535207 vs. TrEMBL
Match: D7TTG5_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_12.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00013232001 PE=4 SV=1) HSP 1 Score: 61.2326 bits (147), Expect = 3.814e-8 Identity = 35/56 (62.50%), Postives = 40/56 (71.43%), Query Frame = 3 Query: 3 PKLVKGESKVVWEWQVEGSLSASKLLTKRDVSKTKVNGNIDL-SCQPRPTMKAELM 167 PKLVKGESKVVWEWQVEGSLS S+L KR+ SK K +G ++ S P MKA M Sbjct: 326 PKLVKGESKVVWEWQVEGSLS-SRLRKKREASKLKPSGGTNINSGVQSPAMKASEM 380
BLAST of FG535207 vs. TrEMBL
Match: B9MTY2_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_589966 PE=4 SV=1) HSP 1 Score: 56.6102 bits (135), Expect = 9.394e-7 Identity = 26/40 (65.00%), Postives = 31/40 (77.50%), Query Frame = 3 Query: 3 PKLVKGESKVVWEWQVEGSLSASKLLTKRDVSKTKVNGNI 122 PKLVKGESKVVWEWQVEGSLS+ ++ K + SK K N + Sbjct: 325 PKLVKGESKVVWEWQVEGSLSSGRMRKKVESSKLKSNDGV 364
BLAST of FG535207 vs. TAIR peptide
Match: AT5G46560.1 (| Symbols: | CONTAINS InterPro DOMAIN/s: Inner nuclear membrane protein MAN1 (InterPro:IPR018996); Has 58 Blast hits to 58 proteins in 29 species: Archae - 0; Bacteria - 4; Metazoa - 11; Fungi - 15; Plants - 20; Viruses - 0; Other Eukaryotes - 8 (source: NCBI BLink). | chr5:18888061-18890090 FORWARD LENGTH=387) HSP 1 Score: 53.9138 bits (128), Expect = 3.403e-8 Identity = 28/42 (66.67%), Postives = 32/42 (76.19%), Query Frame = 3 Query: 6 KLVKGESKVVWEWQVEGSLSASKLLTKRDVSKTKVNGNIDLS 131 KL+KGE KVVWEWQVEGSLS SKL +R+ K KV +ID S Sbjct: 331 KLLKGEKKVVWEWQVEGSLSLSKLKKQRETQK-KVRKSIDSS 371 The following BLAST results are available for this feature:
BLAST of FG535207 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl) Total hits: 2
BLAST of FG535207 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide) Total hits: 1
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FG535207 ID=FG535207; Name=FG535207; organism=Pisum sativum; type=EST; length=411bpback to top |