FG537509
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FG537509 vs. Lotus protein
Match: chr4.CM0229.130.r2.m (+ phase: 0 ) HSP 1 Score: 53.9138 bits (128), Expect = 1.586e-8 Identity = 27/38 (71.05%), Postives = 30/38 (78.95%), Query Frame = 1 Query: 4 PTYSG-SPSSKINESQAKHIFDMDMVVDQGGY-ADSMW 111 PTY+ PSSKI ESQAKH+FDMDM+VD GY DSMW Sbjct: 137 PTYTSVPPSSKILESQAKHVFDMDMMVDHAGYGGDSMW 174
BLAST of FG537509 vs. Medicago proteins
Match: IMGA|Medtr4g083680.1 (LOB domain-containing protein 4 (AHRD V1 ***- Q9SHE9); contains Interpro domain(s) IPR004883 Lateral organ boundaries, LOB chr04_pseudomolecule_IMGAG_V3.5 28617102-28620592 E EGN_Mt100125 20100825) HSP 1 Score: 65.855 bits (159), Expect = 5.726e-12 Identity = 32/37 (86.49%), Postives = 33/37 (89.19%), Query Frame = 1 Query: 4 PTYSGSPSSKINESQ-AKHIFDMDMVVDQGGYADSMW 111 PTYSGSPSSKINESQ AK+IFDMDMVVDQ Y DSMW Sbjct: 138 PTYSGSPSSKINESQQAKNIFDMDMVVDQAAYGDSMW 174 The following BLAST results are available for this feature:
BLAST of FG537509 vs. Lotus protein
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Lotus proteins) Total hits: 1
BLAST of FG537509 vs. Medicago proteins
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Medicago proteins) Total hits: 1
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FG537509 ID=FG537509; Name=FG537509; organism=Pisum sativum; type=EST; length=225bpback to top |