FG528786
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FG528786 vs. Lotus protein
Match: LjSGA_026171.1 (- phase: 1 /partial) HSP 1 Score: 58.151 bits (139), Expect = 8.876e-10 Identity = 29/51 (56.86%), Postives = 38/51 (74.51%), Query Frame = 2 Query: 146 KEGSWLEQGRKIGEDQVVPLPRNFNGIDIESGGSYRICSRHILLKSGSNYI 298 +E SWLEQG K+GE QVVPL RNFNG+DIES + + RH+ +K+ S+ I Sbjct: 112 RERSWLEQGHKVGE-QVVPLARNFNGVDIESANN--LMERHVEMKTNSDVI 159
BLAST of FG528786 vs. Soybean peptides
Match: Glyma11g37940.1|PACid:16285764 () HSP 1 Score: 53.1434 bits (126), Expect = 6.717e-8 Identity = 26/35 (74.29%), Postives = 29/35 (82.86%), Query Frame = 2 Query: 146 KEGSWLEQGRKIGEDQVVPLPRNFNGIDIESGGSY 250 KE SWLEQG K+GE QVVPL RNFN IDIESG ++ Sbjct: 533 KERSWLEQGCKVGE-QVVPLARNFNNIDIESGNNF 566
BLAST of FG528786 vs. Soybean peptides
Match: Glyma18g01850.1|PACid:16307619 () HSP 1 Score: 50.8322 bits (120), Expect = 3.334e-7 Identity = 25/35 (71.43%), Postives = 28/35 (80.00%), Query Frame = 2 Query: 146 KEGSWLEQGRKIGEDQVVPLPRNFNGIDIESGGSY 250 KE SWLEQG K+GE QVVPL RNFN IDIES ++ Sbjct: 533 KERSWLEQGCKVGE-QVVPLARNFNNIDIESSNNF 566
BLAST of FG528786 vs. Medicago proteins
Match: IMGA|Medtr3g086840.1 (LMBR1 domain-containing protein 2 homolog A (AHRD V1 ***- Q54Q92); contains Interpro domain(s) IPR006876 LMBR1-like conserved region chr03_pseudomolecule_IMGAG_V3.5 28646754-28637161 E EGN_Mt100125 20100825) HSP 1 Score: 65.0846 bits (157), Expect = 1.041e-11 Identity = 29/35 (82.86%), Postives = 32/35 (91.43%), Query Frame = 2 Query: 146 KEGSWLEQGRKIGEDQVVPLPRNFNGIDIESGGSY 250 KE SWLEQGRKIGE+QVVPL RNFNG+DIESG +Y Sbjct: 533 KERSWLEQGRKIGEEQVVPLARNFNGLDIESGNNY 567 The following BLAST results are available for this feature:
BLAST of FG528786 vs. Lotus protein
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Lotus proteins) Total hits: 1
BLAST of FG528786 vs. Soybean peptides
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Soybean peptides) Total hits: 2
BLAST of FG528786 vs. Medicago proteins
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Medicago proteins) Total hits: 1
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FG528786 ID=FG528786; Name=FG528786; organism=Pisum sativum; type=EST; length=373bpback to top |