AM161718
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of AM161718 vs. TrEMBL
Match: Q9STA2_MEDSA (Hydroperoxide lyase OS=Medicago sativa GN=cyp74B4v2 PE=2 SV=1) HSP 1 Score: 60.8474 bits (146), Expect = 5.062e-8 Identity = 24/30 (80.00%), Postives = 29/30 (96.67%), Query Frame = -2 Query: 186 EELFLHSFSYPFSLVKGDYNSLYNFVKQHG 275 EE+FLHSFSYP++LV GDYN+LYNF+KQHG Sbjct: 238 EEIFLHSFSYPYALVSGDYNNLYNFIKQHG 267
BLAST of AM161718 vs. TrEMBL
Match: Q4ZGM9_MEDTR (13-hydroperoxide lyase OS=Medicago truncatula GN=HPL3 PE=2 SV=1) HSP 1 Score: 60.4622 bits (145), Expect = 6.611e-8 Identity = 24/30 (80.00%), Postives = 28/30 (93.33%), Query Frame = -2 Query: 186 EELFLHSFSYPFSLVKGDYNSLYNFVKQHG 275 EE+FLHSFSYP++LV GDYN LYNF+KQHG Sbjct: 238 EEIFLHSFSYPYALVSGDYNKLYNFIKQHG 267
BLAST of AM161718 vs. TrEMBL
Match: Q9STA3_MEDSA (Hydroperoxide lyase OS=Medicago sativa GN=cyp74B4v1 PE=2 SV=1) HSP 1 Score: 58.5362 bits (140), Expect = 2.512e-7 Identity = 23/30 (76.67%), Postives = 28/30 (93.33%), Query Frame = -2 Query: 186 EELFLHSFSYPFSLVKGDYNSLYNFVKQHG 275 EE+FLHSFSYP++LV GDY +LYNF+KQHG Sbjct: 238 EEIFLHSFSYPYALVSGDYKNLYNFIKQHG 267
BLAST of AM161718 vs. TrEMBL
Match: Q9STA1_MEDSA (Hydroperoxide lyase OS=Medicago sativa GN=cyp74B4v3 PE=2 SV=1) HSP 1 Score: 58.5362 bits (140), Expect = 2.512e-7 Identity = 23/30 (76.67%), Postives = 28/30 (93.33%), Query Frame = -2 Query: 186 EELFLHSFSYPFSLVKGDYNSLYNFVKQHG 275 EE+FLHSFSYP++LV GDY +LYNF+KQHG Sbjct: 238 EEIFLHSFSYPYALVSGDYKNLYNFIKQHG 267 The following BLAST results are available for this feature:
BLAST of AM161718 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl) Total hits: 4
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >AM161718 ID=AM161718; Name=AM161718; organism=Pisum sativum; type=EST; length=276bpback to top |