EX569765
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EX569765 vs. Lotus protein
Match: LjSGA_089926.0.1 (- phase: 0 /est) HSP 1 Score: 56.9954 bits (136), Expect = 2.420e-9 Identity = 31/69 (44.93%), Postives = 42/69 (60.87%), Query Frame = 3 Query: 39 ESKKVEEKNKFSVFDVLKILSESSVEEEGDG--LTVLEAAKRSVITFPRPSWWP---DHMKSELFNFDD 230 E K EK KFS +DVLK+++E++ D L++LE A+ ITFPRP WWP D S LF F++ Sbjct: 172 ELKSGPEKRKFSGYDVLKVMAENNAHRSKDEPTLSLLETARLIGITFPRPRWWPKNDDRFASGLFLFEE 240
BLAST of EX569765 vs. Soybean peptides
Match: Glyma15g01400.1|PACid:16297235 () HSP 1 Score: 50.8322 bits (120), Expect = 4.092e-7 Identity = 26/51 (50.98%), Postives = 34/51 (66.67%), Query Frame = 3 Query: 54 EEKNKFSVFDVLKILSE--SSVEEEGDG-LTVLEAAKRSVITFPRPSWWPD 197 E++ F VF VLK SE S+VEE D LT+L+ A+ +TFPRP WWP+ Sbjct: 205 EKRKAFDVFAVLKAFSELESTVEENNDHHLTLLDVARARGVTFPRPRWWPE 255
BLAST of EX569765 vs. Medicago proteins
Match: IMGA|Medtr3g116810.1 (Unknown Protein (AHRD V1) chr03_pseudomolecule_IMGAG_V3.5 42386280-42387565 E EGN_Mt100125 20100825) HSP 1 Score: 83.1889 bits (204), Expect = 4.572e-17 Identity = 44/78 (56.41%), Postives = 55/78 (70.51%), Query Frame = 3 Query: 15 EKATPN--------GLESKKVEEKNKFSVFDVLKILSESSVEEEGDGLTVLEAAKRSVITFPRPSWWPDHMKSELFNF 224 EKAT N + +K +EK +VFDVLK L+++SV+E+ DGLT+LE KR+ I FPRPSWWPD MKSELFNF Sbjct: 221 EKATANERGSGEDKDKDKEKEKEKETLTVFDVLKFLAKTSVKED-DGLTLLETLKRAGIKFPRPSWWPDDMKSELFNF 297 The following BLAST results are available for this feature:
BLAST of EX569765 vs. Lotus protein
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Lotus proteins) Total hits: 1
BLAST of EX569765 vs. Soybean peptides
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Soybean peptides) Total hits: 1
BLAST of EX569765 vs. Medicago proteins
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Medicago proteins) Total hits: 1
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >EX569765 ID=EX569765; Name=EX569765; organism=Pisum sativum; type=EST; length=405bpback to top |