EX570561
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EX570561 vs. TrEMBL
Match: B9RI11_RICCO (Nucleolar complex-associated protein, putative OS=Ricinus communis GN=RCOM_1575060 PE=4 SV=1) HSP 1 Score: 59.6918 bits (143), Expect = 1.097e-7 Identity = 28/61 (45.90%), Postives = 42/61 (68.85%), Query Frame = 2 Query: 2 RNGNATSDTIGSTSVTRSFNEDDLRRKFSSHFMILHEIKENERLRRKLNKTAQSLQLYEQY 184 R G++ I T S +ED+LR+KFS HF++L ++KENERLR +L+ +LQLY++Y Sbjct: 761 RKGSSKISVIDRILDTVSADEDELRKKFSDHFVLLRDLKENERLRGQLDHATLALQLYDEY 821
BLAST of EX570561 vs. TrEMBL
Match: D7T0Y6_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_85.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00036806001 PE=4 SV=1) HSP 1 Score: 56.9954 bits (136), Expect = 7.114e-7 Identity = 28/61 (45.90%), Postives = 42/61 (68.85%), Query Frame = 2 Query: 5 NGNATSDTIGST-SVTRSFNEDDLRRKFSSHFMILHEIKENERLRRKLNKTAQSLQLYEQY 184 +G++ + +I T +ED LR+K S HF ILH+IKENERLR +L++ SLQ+YE++ Sbjct: 767 SGSSGAASINPTPDAATPIDEDGLRKKLSEHFTILHDIKENERLRGELDRVTLSLQVYEEH 827
BLAST of EX570561 vs. TrEMBL
Match: B9H628_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_650939 PE=4 SV=1) HSP 1 Score: 56.9954 bits (136), Expect = 7.114e-7 Identity = 24/46 (52.17%), Postives = 36/46 (78.26%), Query Frame = 2 Query: 47 TRSFNEDDLRRKFSSHFMILHEIKENERLRRKLNKTAQSLQLYEQY 184 T S +ED+LR+K S HF +L + KE+E+LR +L++T +LQLYE+Y Sbjct: 212 TGSLDEDELRKKLSDHFSLLRDFKESEKLRTELDRTTSALQLYEEY 257 The following BLAST results are available for this feature:
BLAST of EX570561 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl) Total hits: 3
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >EX570561 ID=EX570561; Name=EX570561; organism=Pisum sativum; type=EST; length=459bpback to top |