FG529861
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FG529861 vs. Medicago proteins
Match: IMGA|AC235488_33.1 (Myb protein-like (AHRD V1 *-*- Q5Z5G1_ORYSJ) AC235488.1 146725-147814 H EGN_Mt100125 20100825) HSP 1 Score: 62.003 bits (149), Expect = 1.203e-10 Identity = 30/69 (43.48%), Postives = 45/69 (65.22%), Query Frame = -2 Query: 211 DKKSKCNVDAKNKRAITVDRLAQAKEDE-------LELRVVQMMMKDTSTMNDSQRDIPEKYCNKMKKK 396 + SK D +KR +++LA KE+E +E + +Q++M DTSTMN+SQR + EKYCNK+K+K Sbjct: 263 ETSSKAVHDLMDKRVAAMEKLAHLKEEENTLKKEEMEFKAMQVIMSDTSTMNESQRQVHEKYCNKLKEK 331
BLAST of FG529861 vs. Medicago proteins
Match: IMGA|Medtr7g114170.1 (Unknown Protein (AHRD V1) chr07_pseudomolecule_IMGAG_V3.5 37049642-37050680 H EGN_Mt100125 20100825) HSP 1 Score: 55.8398 bits (133), Expect = 8.624e-9 Identity = 29/68 (42.65%), Postives = 42/68 (61.76%), Query Frame = -2 Query: 211 DKKSKCNVDAKNKRAITVDRLAQAKEDELELRVVQM------MMKDTSTMNDSQRDIPEKYCNKMKKK 396 + SK D +KR +++LA KE+E L+ +M +M D STMN+SQR + EKYCNK+K+K Sbjct: 219 ETSSKAMHDTMDKRVAAMEKLAHLKEEENILKKEEMEFKAMQVMSDMSTMNESQRQVHEKYCNKLKEK 286 The following BLAST results are available for this feature:
BLAST of FG529861 vs. Medicago proteins
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Medicago proteins) Total hits: 2
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v2
Date Performed: 2011-04-27
Analysis Name: InterProScan analysis for Pisum sativum unigene v1 Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FG529861 ID=FG529861; Name=FG529861; organism=Pisum sativum; type=EST; length=421bpback to top |