FG535961
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FG535961 vs. TrEMBL
Match: C6TB65_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 75.8702 bits (185), Expect = 1.643e-12 Identity = 32/37 (86.49%), Postives = 34/37 (91.89%), Query Frame = 1 Query: 1 LTYSYCYDKIRYKAPPSECAINPQEAERLRRFDPVTF 111 +TYSYCYDK+RYK PPSEC IN QEAERLRRFDPVTF Sbjct: 271 MTYSYCYDKVRYKVPPSECVINSQEAERLRRFDPVTF 307
BLAST of FG535961 vs. TrEMBL
Match: C0IRI3_MALDO (Xyloglucan endotransglucosylase/hydrolase 10 OS=Malus domestica PE=2 SV=1) HSP 1 Score: 75.485 bits (184), Expect = 2.146e-12 Identity = 32/37 (86.49%), Postives = 35/37 (94.59%), Query Frame = 1 Query: 1 LTYSYCYDKIRYKAPPSECAINPQEAERLRRFDPVTF 111 +TYSYCYD+IRYK+PPSEC INPQEAERLR FDPVTF Sbjct: 275 MTYSYCYDRIRYKSPPSECVINPQEAERLRVFDPVTF 311
BLAST of FG535961 vs. TrEMBL
Match: C0IRH2_ACTDE (Xyloglucan endotransglucosylase/hydrolase 13 OS=Actinidia deliciosa PE=2 SV=1) HSP 1 Score: 72.7886 bits (177), Expect = 1.391e-11 Identity = 31/37 (83.78%), Postives = 33/37 (89.19%), Query Frame = 1 Query: 1 LTYSYCYDKIRYKAPPSECAINPQEAERLRRFDPVTF 111 + YSYCYD+ RYK PPSECAINPQEAERLR FDPVTF Sbjct: 269 MQYSYCYDRTRYKVPPSECAINPQEAERLRGFDPVTF 305
BLAST of FG535961 vs. TrEMBL
Match: D7T8G6_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_11.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00011603001 PE=4 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 2.372e-11 Identity = 29/37 (78.38%), Postives = 33/37 (89.19%), Query Frame = 1 Query: 1 LTYSYCYDKIRYKAPPSECAINPQEAERLRRFDPVTF 111 +TYSYCYD++RY PPSEC +N QEAERLRRFDPVTF Sbjct: 271 MTYSYCYDRVRYTVPPSECVVNAQEAERLRRFDPVTF 307
BLAST of FG535961 vs. TrEMBL
Match: A5B2H6_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_018042 PE=4 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 2.372e-11 Identity = 29/37 (78.38%), Postives = 33/37 (89.19%), Query Frame = 1 Query: 1 LTYSYCYDKIRYKAPPSECAINPQEAERLRRFDPVTF 111 +TYSYCYD++RY PPSEC +N QEAERLRRFDPVTF Sbjct: 271 MTYSYCYDRVRYTVPPSECVVNAQEAERLRRFDPVTF 307
BLAST of FG535961 vs. TrEMBL
Match: A2TEJ2_POPTN (Xyloglucan endotransglycosylase/hydrolase XTH-39 OS=Populus tremula PE=2 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 3.098e-11 Identity = 28/37 (75.68%), Postives = 34/37 (91.89%), Query Frame = 1 Query: 1 LTYSYCYDKIRYKAPPSECAINPQEAERLRRFDPVTF 111 +TYSYCYD++RYK PPSEC INP+EA+RL+ FDPVTF Sbjct: 276 MTYSYCYDRVRYKVPPSECVINPKEADRLKSFDPVTF 312
BLAST of FG535961 vs. TrEMBL
Match: B9SNH8_RICCO (Xyloglucan endotransglucosylase/hydrolase protein 2, putative OS=Ricinus communis GN=RCOM_1150010 PE=4 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 6.903e-11 Identity = 28/37 (75.68%), Postives = 33/37 (89.19%), Query Frame = 1 Query: 1 LTYSYCYDKIRYKAPPSECAINPQEAERLRRFDPVTF 111 +TYSYCYD++RYK PPSEC +NPQEA RL+ FDPVTF Sbjct: 278 MTYSYCYDRVRYKNPPSECLVNPQEAARLKSFDPVTF 314
BLAST of FG535961 vs. TrEMBL
Match: B9HJJ8_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_720800 PE=4 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 9.015e-11 Identity = 27/37 (72.97%), Postives = 33/37 (89.19%), Query Frame = 1 Query: 1 LTYSYCYDKIRYKAPPSECAINPQEAERLRRFDPVTF 111 +TYSYCYD++RYK PPSEC NP+EA+RL+ FDPVTF Sbjct: 276 MTYSYCYDRVRYKVPPSECVFNPKEADRLKSFDPVTF 312
BLAST of FG535961 vs. TrEMBL
Match: B9HVR7_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_658681 PE=4 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 4.474e-10 Identity = 26/37 (70.27%), Postives = 34/37 (91.89%), Query Frame = 1 Query: 1 LTYSYCYDKIRYKAPPSECAINPQEAERLRRFDPVTF 111 +TYSYCYD++RY+APPSEC IN +EA+RL+ +DPVTF Sbjct: 276 MTYSYCYDRVRYRAPPSECVINTKEADRLKSYDPVTF 312
BLAST of FG535961 vs. TrEMBL
Match: A9P987_POPTR (Putative uncharacterized protein OS=Populus trichocarpa PE=2 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 5.843e-10 Identity = 26/37 (70.27%), Postives = 32/37 (86.49%), Query Frame = 1 Query: 1 LTYSYCYDKIRYKAPPSECAINPQEAERLRRFDPVTF 111 +TYSYCYD++RYK PPSEC NP+ A+RL+ FDPVTF Sbjct: 276 MTYSYCYDRVRYKVPPSECVFNPKVADRLKSFDPVTF 312
BLAST of FG535961 vs. SwissProt
Match: XTH28_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 28 OS=Arabidopsis thaliana GN=XTH28 PE=2 SV=1) HSP 1 Score: 60.077 bits (144), Expect = 7.291e-9 Identity = 25/37 (67.57%), Postives = 30/37 (81.08%), Query Frame = 1 Query: 1 LTYSYCYDKIRYKAPPSECAINPQEAERLRRFDPVTF 111 +TYSYCYD +RYK SEC +NP EA+RLR +DPVTF Sbjct: 272 MTYSYCYDHMRYKVVLSECVVNPAEAKRLRVYDPVTF 308
BLAST of FG535961 vs. SwissProt
Match: XTH27_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 27 OS=Arabidopsis thaliana GN=XTH27 PE=2 SV=2) HSP 1 Score: 56.9954 bits (136), Expect = 6.172e-8 Identity = 23/37 (62.16%), Postives = 28/37 (75.68%), Query Frame = 1 Query: 1 LTYSYCYDKIRYKAPPSECAINPQEAERLRRFDPVTF 111 +TYSYCYD+ RY SEC +NP EA+RLR +DPV F Sbjct: 272 MTYSYCYDRARYNVALSECVVNPAEAQRLRVYDPVRF 308
BLAST of FG535961 vs. TAIR peptide
Match: AT1G14720.1 (| Symbols: XTR2, EXGT-A2, ATXTH28, XTH28 | xyloglucan endotransglucosylase/hydrolase 28 | chr1:5066806-5068466 REVERSE LENGTH=332) HSP 1 Score: 60.077 bits (144), Expect = 8.078e-10 Identity = 25/37 (67.57%), Postives = 30/37 (81.08%), Query Frame = 1 Query: 1 LTYSYCYDKIRYKAPPSECAINPQEAERLRRFDPVTF 111 +TYSYCYD +RYK SEC +NP EA+RLR +DPVTF Sbjct: 272 MTYSYCYDHMRYKVVLSECVVNPAEAKRLRVYDPVTF 308
BLAST of FG535961 vs. TAIR peptide
Match: AT2G01850.1 (| Symbols: EXGT-A3, XTH27, ATXTH27 | endoxyloglucan transferase A3 | chr2:385374-387138 FORWARD LENGTH=333) HSP 1 Score: 56.9954 bits (136), Expect = 6.839e-9 Identity = 23/37 (62.16%), Postives = 28/37 (75.68%), Query Frame = 1 Query: 1 LTYSYCYDKIRYKAPPSECAINPQEAERLRRFDPVTF 111 +TYSYCYD+ RY SEC +NP EA+RLR +DPV F Sbjct: 272 MTYSYCYDRARYNVALSECVVNPAEAQRLRVYDPVRF 308 The following BLAST results are available for this feature:
BLAST of FG535961 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl) Total hits: 10
BLAST of FG535961 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Swissprot) Total hits: 2
BLAST of FG535961 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide) Total hits: 2
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FG535961 ID=FG535961; Name=FG535961; organism=Pisum sativum; type=EST; length=516bpback to top Annotated Terms
The
following terms have been associated with
this EST:
|