AM161993
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of AM161993 vs. TrEMBL
Match: D7KDL8_ARALY (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_471797 PE=4 SV=1) HSP 1 Score: 59.3066 bits (142), Expect = 1.443e-7 Identity = 27/42 (64.29%), Postives = 30/42 (71.43%), Query Frame = 1 Query: 1 TDRGKQCYELNKNVRWANVXXXXXXXXXXAEYTDSLGVLRGR 126 TDRGKQ YELNKNVRWANV AEYTD +G+L+GR Sbjct: 152 TDRGKQTYELNKNVRWANVYDPDDHWPEPAEYTDMIGILKGR 193
BLAST of AM161993 vs. TrEMBL
Match: Q9S9N6_ARATH (At1g15980/T24D18_8 OS=Arabidopsis thaliana GN=At1g15980 PE=2 SV=1) HSP 1 Score: 56.9954 bits (136), Expect = 7.160e-7 Identity = 26/42 (61.90%), Postives = 30/42 (71.43%), Query Frame = 1 Query: 1 TDRGKQCYELNKNVRWANVXXXXXXXXXXAEYTDSLGVLRGR 126 T+RGKQ YELNKNVRWANV AEYTD +G+L+GR Sbjct: 153 TERGKQTYELNKNVRWANVYDPDDHWPEPAEYTDMIGLLKGR 194
BLAST of AM161993 vs. TAIR peptide
Match: AT1G15980.1 (| Symbols: NDF1, NDH48 | NDH-dependent cyclic electron flow 1 | chr1:5489314-5491199 FORWARD LENGTH=461) HSP 1 Score: 56.9954 bits (136), Expect = 2.799e-9 Identity = 26/42 (61.90%), Postives = 30/42 (71.43%), Query Frame = 1 Query: 1 TDRGKQCYELNKNVRWANVXXXXXXXXXXAEYTDSLGVLRGR 126 T+RGKQ YELNKNVRWANV AEYTD +G+L+GR Sbjct: 153 TERGKQTYELNKNVRWANVYDPDDHWPEPAEYTDMIGLLKGR 194 The following BLAST results are available for this feature:
BLAST of AM161993 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl) Total hits: 2
BLAST of AM161993 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide) Total hits: 1
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >AM161993 ID=AM161993; Name=AM161993; organism=Pisum sativum; type=EST; length=127bpback to top |