FG530941
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FG530941 vs. TrEMBL
Match: Q5JNJ6_ORYSJ (Dynamin-like OS=Oryza sativa subsp. japonica GN=P0481E12.20 PE=4 SV=1) HSP 1 Score: 65.0846 bits (157), Expect = 4.124e-9 Identity = 29/39 (74.36%), Postives = 36/39 (92.31%), Query Frame = 3 Query: 6 MFVAPGAIDVLQNEREFLVKRQKILHTCLNEFKNVSRSL 122 MFVAPGA+D +QNER+ L+KRQKIL +CLNEFKN+SR+L Sbjct: 784 MFVAPGAVDAIQNERQSLLKRQKILLSCLNEFKNISRTL 822
BLAST of FG530941 vs. TrEMBL
Match: C5XK26_SORBI (Putative uncharacterized protein Sb03g034500 OS=Sorghum bicolor GN=Sb03g034500 PE=4 SV=1) HSP 1 Score: 65.0846 bits (157), Expect = 4.124e-9 Identity = 29/39 (74.36%), Postives = 36/39 (92.31%), Query Frame = 3 Query: 6 MFVAPGAIDVLQNEREFLVKRQKILHTCLNEFKNVSRSL 122 MFVAPGA+D +QNER+ L+KRQKIL +CLNEFKN+SR+L Sbjct: 787 MFVAPGAVDAIQNERQSLLKRQKILLSCLNEFKNISRAL 825
BLAST of FG530941 vs. TrEMBL
Match: B9EZN2_ORYSJ (Putative uncharacterized protein OS=Oryza sativa subsp. japonica GN=OsJ_03445 PE=4 SV=1) HSP 1 Score: 65.0846 bits (157), Expect = 4.124e-9 Identity = 29/39 (74.36%), Postives = 36/39 (92.31%), Query Frame = 3 Query: 6 MFVAPGAIDVLQNEREFLVKRQKILHTCLNEFKNVSRSL 122 MFVAPGA+D +QNER+ L+KRQKIL +CLNEFKN+SR+L Sbjct: 756 MFVAPGAVDAIQNERQSLLKRQKILLSCLNEFKNISRTL 794
BLAST of FG530941 vs. TrEMBL
Match: B8A9E8_ORYSI (Putative uncharacterized protein OS=Oryza sativa subsp. indica GN=OsI_03724 PE=4 SV=1) HSP 1 Score: 65.0846 bits (157), Expect = 4.124e-9 Identity = 29/39 (74.36%), Postives = 36/39 (92.31%), Query Frame = 3 Query: 6 MFVAPGAIDVLQNEREFLVKRQKILHTCLNEFKNVSRSL 122 MFVAPGA+D +QNER+ L+KRQKIL +CLNEFKN+SR+L Sbjct: 784 MFVAPGAVDAIQNERQSLLKRQKILLSCLNEFKNISRTL 822
BLAST of FG530941 vs. TrEMBL
Match: B9HZT8_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_568891 PE=4 SV=1) HSP 1 Score: 64.3142 bits (155), Expect = 7.035e-9 Identity = 31/39 (79.49%), Postives = 35/39 (89.74%), Query Frame = 3 Query: 6 MFVAPGAIDVLQNEREFLVKRQKILHTCLNEFKNVSRSL 122 MFVAPGAIDVLQNER L KRQKIL +CLNEFK+++RSL Sbjct: 33 MFVAPGAIDVLQNERHSLQKRQKILQSCLNEFKSLARSL 71
BLAST of FG530941 vs. TrEMBL
Match: Q1EP28_MUSBA (Dynamin family protein OS=Musa balbisiana GN=MBP_91N22.54 PE=4 SV=1) HSP 1 Score: 63.5438 bits (153), Expect = 1.200e-8 Identity = 29/39 (74.36%), Postives = 35/39 (89.74%), Query Frame = 3 Query: 6 MFVAPGAIDVLQNEREFLVKRQKILHTCLNEFKNVSRSL 122 MFVAPGAIDVLQ ER+ L KRQK+L +CLNEFKN++R+L Sbjct: 780 MFVAPGAIDVLQGERQSLNKRQKVLQSCLNEFKNIARAL 818
BLAST of FG530941 vs. TrEMBL
Match: C0P376_MAIZE (Putative uncharacterized protein OS=Zea mays PE=2 SV=1) HSP 1 Score: 63.5438 bits (153), Expect = 1.200e-8 Identity = 29/40 (72.50%), Postives = 35/40 (87.50%), Query Frame = 3 Query: 3 GMFVAPGAIDVLQNEREFLVKRQKILHTCLNEFKNVSRSL 122 GMFV PGA+D +QNER L+KRQKIL +CLNEFKN+SR+L Sbjct: 685 GMFVLPGAVDGIQNERHSLLKRQKILLSCLNEFKNISRAL 724
BLAST of FG530941 vs. TrEMBL
Match: B4FFL3_MAIZE (Putative uncharacterized protein OS=Zea mays PE=2 SV=2) HSP 1 Score: 63.5438 bits (153), Expect = 1.200e-8 Identity = 29/40 (72.50%), Postives = 35/40 (87.50%), Query Frame = 3 Query: 3 GMFVAPGAIDVLQNEREFLVKRQKILHTCLNEFKNVSRSL 122 GMFV PGA+D +QNER L+KRQKIL +CLNEFKN+SR+L Sbjct: 418 GMFVLPGAVDGIQNERHSLLKRQKILLSCLNEFKNISRAL 457
BLAST of FG530941 vs. TrEMBL
Match: D7KKE2_ARALY (Dynamin family protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_474434 PE=4 SV=1) HSP 1 Score: 63.1586 bits (152), Expect = 1.567e-8 Identity = 31/39 (79.49%), Postives = 34/39 (87.18%), Query Frame = 3 Query: 6 MFVAPGAIDVLQNEREFLVKRQKILHTCLNEFKNVSRSL 122 MFVAPGAIDVLQNER+ L KRQKIL +CL EFK V+RSL Sbjct: 779 MFVAPGAIDVLQNERQQLQKRQKILQSCLTEFKTVARSL 817
BLAST of FG530941 vs. TrEMBL
Match: B4FIA8_MAIZE (Putative uncharacterized protein OS=Zea mays PE=2 SV=1) HSP 1 Score: 62.3882 bits (150), Expect = 2.673e-8 Identity = 28/39 (71.79%), Postives = 35/39 (89.74%), Query Frame = 3 Query: 6 MFVAPGAIDVLQNEREFLVKRQKILHTCLNEFKNVSRSL 122 MFVAPGA+D +QNER L+KRQKIL +CL+EFKN+SR+L Sbjct: 177 MFVAPGAVDAIQNERNSLLKRQKILLSCLHEFKNISRAL 215
BLAST of FG530941 vs. TAIR peptide
Match: AT1G53140.1 (| Symbols: DRP5A | Dynamin related protein 5A | chr1:19799271-19802441 FORWARD LENGTH=817) HSP 1 Score: 59.6918 bits (143), Expect = 1.327e-9 Identity = 30/39 (76.92%), Postives = 33/39 (84.62%), Query Frame = 3 Query: 6 MFVAPGAIDVLQNEREFLVKRQKILHTCLNEFKNVSRSL 122 MFVAPGAI VLQNER+ L KRQKIL +CL EFK V+RSL Sbjct: 779 MFVAPGAIVVLQNERQQLQKRQKILQSCLTEFKTVARSL 817 The following BLAST results are available for this feature:
BLAST of FG530941 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl) Total hits: 10
BLAST of FG530941 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide) Total hits: 1
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FG530941 ID=FG530941; Name=FG530941; organism=Pisum sativum; type=EST; length=587bpback to top |