FG531263
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FG531263 vs. Soybean peptides
Match: Glyma05g20990.1|PACid:16259152 () HSP 1 Score: 57.7658 bits (138), Expect = 4.816e-9 Identity = 35/73 (47.95%), Postives = 41/73 (56.16%), Query Frame = 1 Query: 247 HKQSPSFLDPLLCEELNFEDDDSDATITELETVFNDSFRVKLQSLPLVFLAITCF*EGVGLVSLSSKKDESRL 465 H SPSFLD LLCEE ++D DA E ET ND +K Q LPLV F E LVSL +K+ E+ L Sbjct: 23 HSHSPSFLDSLLCEERETFEEDFDANGDECETENNDPSVIKSQPLPLVLYDNDLFWEDDELVSLIAKEGETHL 95
BLAST of FG531263 vs. Soybean peptides
Match: Glyma17g18360.1|PACid:16306012 () HSP 1 Score: 55.4546 bits (132), Expect = 2.390e-8 Identity = 34/71 (47.89%), Postives = 41/71 (57.75%), Query Frame = 1 Query: 256 SPSFLDPLLCEELNFEDDDSDATITELETVFNDSFRVKLQSLPLVFLAITCF*EGVGLVSLSSKKDESRLC 468 SPSFLD LLCEE ++D D E ET N+ +K QSLPLV F E LVSL +K+ E+ LC Sbjct: 11 SPSFLDALLCEERETFEEDFDENGYERETENNEPSVIKSQSLPLVLHDNDLFWEDEELVSLIAKEGETHLC 81 The following BLAST results are available for this feature:
BLAST of FG531263 vs. Soybean peptides
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Soybean peptides) Total hits: 2
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v2
Date Performed: 2011-04-27
Analysis Name: InterProScan analysis for Pisum sativum unigene v1 Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FG531263 ID=FG531263; Name=FG531263; organism=Pisum sativum; type=EST; length=470bpback to top |