FG535007
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FG535007 vs. TrEMBL
Match: C6SYZ6_SOYBN (Putative uncharacterized protein (Fragment) OS=Glycine max PE=2 SV=1) HSP 1 Score: 63.5438 bits (153), Expect = 7.673e-9 Identity = 28/49 (57.14%), Postives = 36/49 (73.47%), Query Frame = -3 Query: 4 FKPTKRNLKNVSHQTPMVHAETAPGRSFGRFQQQYPLPASWRLQLFWLM 150 ++P KRNL NV++QTPM H +T G SFG+F QY ASW L+LFWL+ Sbjct: 3 YEPMKRNLNNVNYQTPMAHVKTVLGHSFGQFLLQYLQHASWILRLFWLI 51
BLAST of FG535007 vs. TAIR peptide
Match: AT1G22140.1 (| Symbols: | unknown protein; Has 40 Blast hits to 40 proteins in 14 species: Archae - 0; Bacteria - 0; Metazoa - 9; Fungi - 0; Plants - 28; Viruses - 0; Other Eukaryotes - 3 (source: NCBI BLink). | chr1:7815158-7815577 REVERSE LENGTH=72) HSP 1 Score: 50.0618 bits (118), Expect = 6.283e-7 Identity = 21/25 (84.00%), Postives = 23/25 (92.00%), Query Frame = 3 Query: 45 DIAAGTVQMNGRELFLHEPWVFDDS 119 DIA+G V MNGRELFLHEPWVFDD+ Sbjct: 46 DIASGRVPMNGRELFLHEPWVFDDT 70 The following BLAST results are available for this feature:
BLAST of FG535007 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl) Total hits: 1
BLAST of FG535007 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide) Total hits: 1
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FG535007 ID=FG535007; Name=FG535007; organism=Pisum sativum; type=EST; length=452bpback to top |