FG538725
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FG538725 vs. Lotus protein
Match: chr2.CM0803.220.r2.d (- phase: 0 ) HSP 1 Score: 80.8777 bits (198), Expect = 1.630e-16 Identity = 38/46 (82.61%), Postives = 44/46 (95.65%), Query Frame = 1 Query: 1 MKASYEEFMVDAQATASRACKTSITELSQKFEKAIDSIRNRHGITS 138 MKASY+EFM DAQA+ASRACKTSITELSQ FEKA+DS+RNR+GI+S Sbjct: 141 MKASYDEFMADAQASASRACKTSITELSQSFEKAVDSLRNRYGISS 186
BLAST of FG538725 vs. Medicago proteins
Match: IMGA|Medtr5g026790.1 (Unknown Protein (AHRD V1) chr05_pseudomolecule_IMGAG_V3.5 10811217-10815475 E EGN_Mt100125 20100825) HSP 1 Score: 82.4185 bits (202), Expect = 7.929e-17 Identity = 39/46 (84.78%), Postives = 44/46 (95.65%), Query Frame = 1 Query: 1 MKASYEEFMVDAQATASRACKTSITELSQKFEKAIDSIRNRHGITS 138 MKASYEEFM +AQATA+RACKTSI ELSQK+EKAIDS+RNRHGI+S Sbjct: 141 MKASYEEFMAEAQATANRACKTSINELSQKYEKAIDSLRNRHGISS 186 The following BLAST results are available for this feature:
BLAST of FG538725 vs. Lotus protein
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Lotus proteins) Total hits: 1
BLAST of FG538725 vs. Medicago proteins
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Medicago proteins) Total hits: 1
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v2
Date Performed: 2011-04-27
Analysis Name: InterProScan analysis for Pisum sativum unigene v1 Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FG538725 ID=FG538725; Name=FG538725; organism=Pisum sativum; type=EST; length=409bpback to top |